{ "version": "2026-10-02", "generated": "2026-10-02", "sourceNote": "One row per molecule, salt forms folded in. Sources: ChEMBL's INN-stem peptides (molecule records read 2026-10-02), Drugs@FDA via openFDA for approved peptides without a peptide stem, and UniProt for endogenous human peptide hormones and neuropeptides. Status is ChEMBL's maximum clinical phase, raised to approved where Drugs@FDA shows an approval, or endogenous for natural peptides with no drug record. gpEntry links a row to its Grey Peptides encyclopedia entry.", "counts": { "rows": 767, "sourced_rows": 767, "with_entry": 342, "without_entry": 425, "source_ids": 875, "by_source_type": { "chembl": 427, "openfda": 29, "uniprot": 214, "pubmed": 170, "pubchem": 30, "clinicaltrials": 5 }, "by_status": { "approved": 136, "withdrawn": 2, "phase-3": 46, "phase-2": 198, "phase-1": 12, "early-phase-1": 0, "preclinical": 1, "unknown": 175, "endogenous": 197 } }, "entries": [ { "id": "5-amino-1mq", "name": "5-Amino-1MQ", "synonyms": [ "5-Amino-1-methylquinolinium", "5-amino-1-methylquinoline", "5A1MQ" ], "moleculeClass": "small-molecule", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 29155147", "url": "https://pubmed.ncbi.nlm.nih.gov/29155147/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "5-amino-1mq", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "abaloparatide", "name": "Abaloparatide", "synonyms": [ "Abaloparatida", "BA-058", "BA058", "BIM-44058", "Bim44058", "Eladynos", "Tymlos" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2017, "sources": [ { "type": "chembl", "id": "CHEMBL3301581", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3301581/", "read": "2026-10-02" } ], "gpEntry": "abaloparatide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2014, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "abarelix", "name": "Abarelix", "synonyms": [ "PPI-149", "Plenaxis", "R-382", "R-3827", "R382", "R3827" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2003, "sources": [ { "type": "chembl", "id": "CHEMBL1252", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1252/", "read": "2026-10-02" } ], "gpEntry": "abarelix", "gpMatch": "name", "innStem": "-relix", "usanYear": 1997, "chemblType": "Protein", "helm": "PEPTIDE1{[ac].[dNal].[dPhe(4-Cl)].[d3-Pal].S.[meY].[dN].L.[X4].P.[dA].[am]}$$$$", "sequence": null }, { "id": "ace-031", "name": "ACE-031", "synonyms": [ "ActRIIB-Fc", "Activin type IIB receptor-Fc fusion", "Ramatercept" ], "moleculeClass": "protein", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 23169607", "url": "https://pubmed.ncbi.nlm.nih.gov/23169607/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "ace-031", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "acetyl-decapeptide-3", "name": "Acetyl Decapeptide-3", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 91936932", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/91936932", "read": "2026-10-02", "note": "PubChem title: Acetyl decapeptide-3" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "acetyl-dipeptide-1-cetyl-ester", "name": "Acetyl Dipeptide-1 Cetyl Ester", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 11685829", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/11685829", "read": "2026-10-02", "note": "PubChem title: Acetyl dipeptide-1 cetyl ester" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "acetyl-hexapeptide-30", "name": "Acetyl Hexapeptide-30", "synonyms": [ "Acetyl Hexapeptide-25 (former INCI)", "Inyline" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 33195061", "url": "https://pubmed.ncbi.nlm.nih.gov/33195061/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "acetyl-hexapeptide-30", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "acetyl-hexapeptide-37", "name": "Acetyl Hexapeptide-37", "synonyms": [ "Ac-SPAGGP-NH2", "Ac-Ser-Pro-Ala-Gly-Gly-Pro-NH2", "Diffuporine" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 18548108", "url": "https://pubmed.ncbi.nlm.nih.gov/18548108/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "acetyl-hexapeptide-37", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "acetyl-octapeptide-3", "name": "Acetyl Octapeptide-3", "synonyms": [ "Acetyl glutamyl heptapeptide-1", "SNAP-8", "Super Argireline" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 18498523", "url": "https://pubmed.ncbi.nlm.nih.gov/18498523/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "acetyl-octapeptide-3", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "acetyl-sh-heptapeptide-1", "name": "acetyl-SH-heptapeptide-1", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 122190547", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/122190547", "read": "2026-10-02", "note": "PubChem title: Acetyl sh-Heptapeptide-1" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "acetyl-tetrapeptide-11", "name": "Acetyl Tetrapeptide-11", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 91936941", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/91936941", "read": "2026-10-02", "note": "PubChem title: Acetyl tetrapeptide-11" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "acetyl-tetrapeptide-3", "name": "Acetyl Tetrapeptide-3", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 11752568", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/11752568", "read": "2026-10-02", "note": "PubChem title: Acetyl tetrapeptide-3" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "acetyl-tetrapeptide-5", "name": "Acetyl Tetrapeptide-5", "synonyms": [ "Ac-bAla-His-Ser-His", "Ac-βAla-His-Ser-His", "Eyeseryl" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 33195061", "url": "https://pubmed.ncbi.nlm.nih.gov/33195061/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "acetyl-tetrapeptide-5", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "acetyl-tetrapeptide-9", "name": "Acetyl Tetrapeptide-9", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 11606295", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/11606295", "read": "2026-10-02", "note": "PubChem title: Acetyl tetrapeptide-9" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "aclerastide", "name": "Aclerastide", "synonyms": [ "Aclerastida", "Asp-arg-nle-tyr-ile-his-pro", "DSC127", "Dsc-127", "Dsc127", "Norleu3-a(1-7)", "Norleu3-angiotensin(1-7)", "USB-001", "USB-005", "USB005" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297940", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297940/", "read": "2026-10-02" } ], "gpEntry": "aclerastide", "gpMatch": "name", "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "act-1-peptide", "name": "Act-1 Peptide", "synonyms": [ "Acti peptide", "Granexin", "Granexin peptide", "Peptide 328967" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297964", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297964/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "adamax", "name": "Adamax", "synonyms": [ "Ac-MEHFPGP-AG-NH2", "Adamax peptide", "N-acetyl Semax with adamantyl P21 modification" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 16996037", "url": "https://pubmed.ncbi.nlm.nih.gov/16996037/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "adamax", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "adipotide", "name": "Adipotide", "synonyms": [ "FTPP", "Fat-Targeted Proapoptotic Peptide", "Prohibitin-TP01" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 22072637", "url": "https://pubmed.ncbi.nlm.nih.gov/22072637/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "adipotide", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "adrenomedullin", "name": "Adrenomedullin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P35318", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P35318/entry", "note": "mature peptide 95-146 of Pro-adrenomedullin" } ], "gpEntry": "adrenomedullin", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY" }, { "id": "adrenomedullin-2", "name": "Adrenomedullin-2", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q7Z4H4", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q7Z4H4/entry", "note": "mature peptide 101-147 of Protein ADM2" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY" }, { "id": "afamelanotide", "name": "Afamelanotide", "synonyms": [ "(nle4,d-phe7)-.alpha.-msh", "A-melanotropin, 4(nle)-7(d-phe)", "Afamelanotida", "CUV-1647", "CUV-1647 ACETATE", "CUV1647", "CUV1647 ACETATE", "Melanotan", "Melanotan i", "Melanotan-1", "Ndp-alpha-msh", "Scenesse" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2014, "sources": [ { "type": "chembl", "id": "CHEMBL441738", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL441738/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL4297213", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297213/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "afamelanotide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2017, "chemblType": "Protein", "helm": "PEPTIDE1{[ac].S.Y.S.[Nle].E.H.[dF].R.W.G.K.P.V.[am]}$$$$", "sequence": null }, { "id": "ahk-cu", "name": "AHK-Cu", "synonyms": [ "AHK copper peptide", "Ala-His-Lys-copper" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 17703734", "url": "https://pubmed.ncbi.nlm.nih.gov/17703734/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "ahk-cu", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "aicar", "name": "AICAR", "synonyms": [ "AICA Ribotide" ], "moleculeClass": "small-molecule", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 65110", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/65110", "read": "2026-10-02", "note": "PubChem title: AICA Ribotide" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "albiglutide", "name": "Albiglutide", "synonyms": [ "Albiglutida", "Albiglutide (genetical recombination)", "Eperzan", "GSK-716155", "GSK716155", "Tanzeum" ], "moleculeClass": "protein", "status": "approved", "maxPhase": 4.0, "firstApproval": 2014, "sources": [ { "type": "chembl", "id": "CHEMBL2107841", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2107841/", "read": "2026-10-02" } ], "gpEntry": "albiglutide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2007, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "albuvirtide", "name": "Albuvirtide", "synonyms": [ "FB-006M", "Labuvirtide" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297257", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297257/", "read": "2026-10-02" } ], "gpEntry": "albuvirtide", "gpMatch": "name", "innStem": "-tide; -vir-", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "alizulatide-vixocianine", "name": "Alizulatide Vixocianine", "synonyms": [ "Alizulatida vixocianina" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068041", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068041/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "almurtide", "name": "Almurtide", "synonyms": [ "Almurtida", "CGP-11637", "Desmethylmuramoyldipeptide", "NORMDP", "Nor-mdp", "Normuramyldipeptide" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3989787", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3989787/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "alpha-msh", "name": "Alpha-MSH", "synonyms": [ "Alpha-Melanocyte Stimulating Hormone", "α-MSH", "α-Melanotropin" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 16763547", "url": "https://pubmed.ncbi.nlm.nih.gov/16763547/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "alpha-msh", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "alpha-neoendorphin", "name": "Alpha-neoendorphin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01213", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01213/entry", "note": "mature peptide 175-184 of Proenkephalin-B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "YGGFLRKYPK" }, { "id": "alprostadil", "name": "Alprostadil", "synonyms": [ "Caverject", "Edex", "MUSE", "PGE1", "Prostaglandin E1", "Prostin VR" ], "moleculeClass": "small-molecule", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 8596569", "url": "https://pubmed.ncbi.nlm.nih.gov/8596569/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "alprostadil", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "alsactide", "name": "Alsactide", "synonyms": [ "Alsactida", "HOE-433", "Synchrodyn" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3989434", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3989434/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "amilomotide", "name": "Amilomotide", "synonyms": [ "Amilomotida", "CAD-106", "CAD106", "Cad106" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108328", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108328/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "amycretin", "name": "Amycretin", "synonyms": [ "NNC0487-0111" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 40550231", "url": "https://pubmed.ncbi.nlm.nih.gov/40550231/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "amycretin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "amylin", "name": "Amylin", "synonyms": [ "AC-001", "AC001", "Amlintida", "Amylin", "Amylin human", "Amylin human amylin", "Islet amyloid polypeptide (human)" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2109025", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2109025/", "read": "2026-10-02" }, { "type": "uniprot", "id": "P10997", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P10997/entry", "note": "mature peptide 34-70 of Islet amyloid polypeptide" } ], "gpEntry": "amylin", "gpMatch": "alias", "innStem": "-tide", "usanYear": 1996, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "anamorelin", "name": "Anamorelin", "synonyms": [ "Anamorelin hcl", "Anamorelina", "Anamoreline", "Ono-7643", "RC-1291", "RC-1291 HCl", "ST-1291" ], "moleculeClass": "small-molecule", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2110579", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2110579/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL2103794", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2103794/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "anamorelin", "gpMatch": "name", "innStem": "-relin", "usanYear": 2007, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "anfibatide", "name": "Anfibatide", "synonyms": [ "Agkisacucetin" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297694", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297694/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "angiotensin-ii", "name": "Angiotensin II", "synonyms": [ "AT-II", "Ang II", "Giapreza", "LJPC-501", "synthetic human angiotensin II" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 28528561", "url": "https://pubmed.ncbi.nlm.nih.gov/28528561/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "angiotensin-ii", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "anidulafungin", "name": "Anidulafungin", "synonyms": [ "Eraxis" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2006, "sources": [ { "type": "openfda", "id": "NDA021632", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=021632", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "anidulafungin", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "anp", "name": "ANP", "synonyms": [ "Anaritida", "WY-47,663", "WY-47,663 ACETATE", "WY-47663 ACETATE" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108934", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108934/", "read": "2026-10-02" } ], "gpEntry": "anp", "gpMatch": "alias", "innStem": "-tide", "usanYear": 1987, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "aod-9604", "name": "AOD-9604", "synonyms": [ "Frag 176-191", "HGH Frag 176-191", "Lipolytic fragment of GH", "hGH fragment 176-191" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 11146367", "url": "https://pubmed.ncbi.nlm.nih.gov/11146367/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "aod-9604", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "apelin", "name": "Apelin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q9ULZ1", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9ULZ1/entry", "note": "mature peptide 65-77 of Apelin" } ], "gpEntry": "apelin", "gpMatch": "alias", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "QRPRLSHKGPMPF" }, { "id": "apelin-28", "name": "Apelin-28", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q9ULZ1", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9ULZ1/entry", "note": "mature peptide 50-77 of Apelin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "NGPGPWQGGRRKFRRQRPRLSHKGPMPF" }, { "id": "apelin-31", "name": "Apelin-31", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q9ULZ1", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9ULZ1/entry", "note": "mature peptide 47-77 of Apelin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "GSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF" }, { "id": "apitegromab", "name": "Apitegromab", "synonyms": [ "SRK-015" ], "moleculeClass": "antibody", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 40818473", "url": "https://pubmed.ncbi.nlm.nih.gov/40818473/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "apitegromab", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "apraglutide", "name": "Apraglutide", "synonyms": [ "FE 203799" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 39461299", "url": "https://pubmed.ncbi.nlm.nih.gov/39461299/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "apraglutide", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "ara-290", "name": "ARA-290", "synonyms": [ "ARA 290", "ARA-290", "ARA290", "Ara 290", "Ara290", "Cibinetida", "Ph-bsp", "Phbsp" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3545305", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3545305/", "read": "2026-10-02" } ], "gpEntry": "ara-290", "gpMatch": "alias", "innStem": "-tide", "usanYear": 2015, "chemblType": "Protein", "helm": "PEPTIDE1{[Glp].E.Q.L.E.R.A.L.N.S.S}$$$$", "sequence": null }, { "id": "arg-vasopressin", "name": "Arg-vasopressin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01185", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01185/entry", "note": "mature peptide 20-28 of Vasopressin-neurophysin 2-copeptin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "CYFQNCPRG" }, { "id": "argipressin-tannate", "name": "Argipressin Tannate", "synonyms": [ "Argipresina", "Argipressin", "Argipressine", "CI-107" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108986", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108986/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-pressin", "usanYear": 1977, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "argiprestocin", "name": "Argiprestocin", "synonyms": [ "8-arginineoxytocin", "Arginine vasotocin", "Argiprestocina", "Argiprestocine" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2370156", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2370156/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tocin", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{C.Y.I.Q.N.C.P.R.G.[am]}$PEPTIDE1,PEPTIDE1,6:R3-1:R3$$$", "sequence": null }, { "id": "argireline", "name": "Argireline", "synonyms": [ "AH-8", "Acetyl Hexapeptide-3", "Acetyl Hexapeptide-8" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 18498523", "url": "https://pubmed.ncbi.nlm.nih.gov/18498523/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "argireline", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "aspartocin", "name": "Aspartocin", "synonyms": [ "A 8999", "A-8999", "Aspartocina", "Aspartocine", "Oxytocin, 4-l-asparagine-" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2104384", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2104384/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tocin", "usanYear": 1963, "chemblType": "Protein", "helm": "PEPTIDE1{C.Y.I.[dN].[dN].C.[dP].L.G.[am]}$PEPTIDE1,PEPTIDE1,6:R3-1:R3$$$", "sequence": null }, { "id": "atosiban", "name": "Atosiban", "synonyms": [ "Antocin", "Tractocile" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 10819855", "url": "https://pubmed.ncbi.nlm.nih.gov/10819855/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "atosiban", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "atriopeptin-1", "name": "Atriopeptin-1", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01160", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01160/entry", "note": "mature peptide 128-148 of Natriuretic peptides A" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "SSCFGGRMDRIGAQSGLGCNS" }, { "id": "atriopeptin-2", "name": "Atriopeptin-2", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01160", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01160/entry", "note": "mature peptide 128-150 of Natriuretic peptides A" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "SSCFGGRMDRIGAQSGLGCNSFR" }, { "id": "atriopeptin-3", "name": "Atriopeptin-3", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01160", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01160/entry", "note": "mature peptide 128-151 of Natriuretic peptides A" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "SSCFGGRMDRIGAQSGLGCNSFRY" }, { "id": "auriculin-a", "name": "Auriculin-A", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01160", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01160/entry", "note": "mature peptide 127-150 of Natriuretic peptides A" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "RSSCFGGRMDRIGAQSGLGCNSFR" }, { "id": "auriculin-b", "name": "Auriculin-B", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01160", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01160/entry", "note": "mature peptide 127-151 of Natriuretic peptides A" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "RSSCFGGRMDRIGAQSGLGCNSFRY" }, { "id": "auriculin-c", "name": "Auriculin-C", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01160", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01160/entry", "note": "mature peptide 119-151 of Natriuretic peptides A" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "LTAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY" }, { "id": "auriculin-d", "name": "Auriculin-D", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01160", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01160/entry", "note": "mature peptide 121-145 of Natriuretic peptides A" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "APRSLRRSSCFGGRMDRIGAQSGLG" }, { "id": "avexitide", "name": "Avexitide", "synonyms": [ "Avexitida", "Exendin (9-39)", "Exendin (9-39) amide", "Exendin (9-39) amide acetate", "Exendin 9-39", "Exendin 9-39 Acetate", "Exendin(9-39)amide", "Exendin-(9-39) acetate", "Exendin-3 (9-39) amide" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297949", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297949/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL4298175", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4298175/", "read": "2026-10-02", "note": "separate ChEMBL record of the same molecule" } ], "gpEntry": "avexitide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2018, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "avorelin", "name": "Avorelin", "synonyms": [ "Avorelina", "Avoreline", "EP-23904", "MF-6001", "Meterelin" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2103984", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2103984/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-relin", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "azagly-nafarelin", "name": "Azagly-nafarelin", "synonyms": [ "Gonazon" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": -1.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068344", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068344/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-relin", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "azd6234", "name": "AZD6234", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "clinicaltrials", "id": "NCT06132841", "url": "https://clinicaltrials.gov/study/NCT06132841", "read": "2026-10-02", "note": "trial registration cited on the encyclopedia entry" } ], "gpEntry": "azd6234", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "azetirelin", "name": "Azetirelin", "synonyms": [ "Azetirelina", "Azetireline" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2104559", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2104559/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-relin", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{[X736].H.P.[am]}$$$$", "sequence": null }, { "id": "bacitracin", "name": "Bacitracin", "synonyms": [ "Bacitracin Zinc And Polymyxin B Sulfate", "Neomycin And Polymyxin B Sulfates And Bacitracin Zinc", "Neomycin And Polymyxin B Sulfates, Bacitracin Zinc And Hydrocortisone" ], "moleculeClass": "blend", "status": "approved", "maxPhase": 4.0, "firstApproval": 1995, "sources": [ { "type": "openfda", "id": "ANDA064046", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=064046", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "bacitracin", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "balixafortide", "name": "Balixafortide", "synonyms": [ "Balixafortida", "POL-6326", "POL6326", "Pol6326" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4802129", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4802129/", "read": "2026-10-02" } ], "gpEntry": "balixafortide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2021, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "baloramotide", "name": "Baloramotide", "synonyms": [ "Baloramotida", "Lage-2, recombinant", "Recombinant ny-eso-1 protein" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4298083", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4298083/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "beinaglutide", "name": "Beinaglutide", "synonyms": [ "Glp-1 (7-36)", "Glucagon like peptide-i (7-36)", "Glucagon-like-peptide-1 (7-36)" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": -1.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5095267", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5095267/", "read": "2026-10-02" }, { "type": "uniprot", "id": "P01275", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01275/entry", "note": "mature peptide 98-127 of Pro-glucagon" } ], "gpEntry": "beinaglutide", "gpMatch": "name", "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "beta-endorphin", "name": "Beta-Endorphin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01189", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01189/entry", "note": "mature peptide 237-267 of Pro-opiomelanocortin" } ], "gpEntry": "beta-endorphin", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE" }, { "id": "beta-neoendorphin", "name": "Beta-neoendorphin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01213", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01213/entry", "note": "mature peptide 175-183 of Proenkephalin-B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "YGGFLRKYP" }, { "id": "betiatide", "name": "Betiatide", "synonyms": [ "Betiatida", "MP-600", "S-benzoylmercaptoacetyltriglycine" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2109104", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2109104/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 1990, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "bevemipretide", "name": "Bevemipretide", "synonyms": [ "Bevemipretida", "SBT-272" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314506", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314506/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "bibapcitide", "name": "Bibapcitide", "synonyms": [ "Bibapcitida", "P-280", "P280", "Technetium tc 99m apcitide dimer" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2106413", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2106413/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 1997, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "big-gastrin", "name": "Big gastrin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01350", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01350/entry", "note": "mature peptide 59-92 of Gastrin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "QLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF" }, { "id": "big-len", "name": "Big LEN", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q9UHG2", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9UHG2/entry", "note": "mature peptide 245-260 of ProSAAS" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "LETPAPQVPARRLLPP" }, { "id": "big-pen-len", "name": "Big PEN-LEN", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q9UHG2", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9UHG2/entry", "note": "mature peptide 221-260 of ProSAAS" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "AADHDVGSELPPEGVLGALLRVKRLETPAPQVPARRLLPP" }, { "id": "big-saas", "name": "Big SAAS", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q9UHG2", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9UHG2/entry", "note": "mature peptide 34-59 of ProSAAS" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "ARPVKEPRGLSAASPPLAETGAPRRF" }, { "id": "bimagrumab", "name": "Bimagrumab", "synonyms": [ "ActRII antibody", "BYM338" ], "moleculeClass": "antibody", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 41772149", "url": "https://pubmed.ncbi.nlm.nih.gov/41772149/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "bimagrumab", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "bioactive-food-peptides", "name": "Bioactive Food Peptides", "synonyms": [ "Casein Peptides", "Dietary Bioactive Peptides", "Food-Derived Peptides", "Whey Peptides" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 20811398", "url": "https://pubmed.ncbi.nlm.nih.gov/20811398/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "bioactive-food-peptides", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "biotinoyl-tripeptide-1", "name": "Biotinoyl Tripeptide-1", "synonyms": [ "Biotinyl-GHK", "Procapil component" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 39609969", "url": "https://pubmed.ncbi.nlm.nih.gov/39609969/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "biotinoyl-tripeptide-1", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "bivalirudin", "name": "Bivalirudin", "synonyms": [ "Angiomax", "Angiomax Rtu" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2000, "sources": [ { "type": "openfda", "id": "NDA020873", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=020873", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "bivalirudin", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "bnp", "name": "BNP", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P16860", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P16860/entry", "note": "mature peptide 27-102 of Natriuretic peptides B" } ], "gpEntry": "bnp", "gpMatch": "alias", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR" }, { "id": "bnp-1-28", "name": "BNP(1-28)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P16860", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P16860/entry", "note": "mature peptide 103-130 of Natriuretic peptides B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "SPKMVQGSGCFGRKMDRISSSSGLGCKV" }, { "id": "bnp-1-29", "name": "BNP(1-29)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P16860", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P16860/entry", "note": "mature peptide 103-131 of Natriuretic peptides B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "SPKMVQGSGCFGRKMDRISSSSGLGCKVL" }, { "id": "bnp-1-30", "name": "BNP(1-30)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P16860", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P16860/entry", "note": "mature peptide 103-132 of Natriuretic peptides B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "SPKMVQGSGCFGRKMDRISSSSGLGCKVLR" }, { "id": "bnp-2-31", "name": "BNP(2-31)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P16860", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P16860/entry", "note": "mature peptide 104-133 of Natriuretic peptides B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "PKMVQGSGCFGRKMDRISSSSGLGCKVLRR" }, { "id": "bnp-3-29", "name": "BNP(3-29)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P16860", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P16860/entry", "note": "mature peptide 105-131 of Natriuretic peptides B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "KMVQGSGCFGRKMDRISSSSGLGCKVL" }, { "id": "bnp-3-30", "name": "BNP(3-30)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P16860", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P16860/entry", "note": "mature peptide 105-132 of Natriuretic peptides B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "KMVQGSGCFGRKMDRISSSSGLGCKVLR" }, { "id": "bnp-3-32", "name": "BNP(3-32)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P16860", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P16860/entry", "note": "mature peptide 105-134 of Natriuretic peptides B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "KMVQGSGCFGRKMDRISSSSGLGCKVLRRH" }, { "id": "bnp-4-27", "name": "BNP(4-27)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P16860", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P16860/entry", "note": "mature peptide 106-129 of Natriuretic peptides B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "MVQGSGCFGRKMDRISSSSGLGCK" }, { "id": "bnp-4-29", "name": "BNP(4-29)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P16860", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P16860/entry", "note": "mature peptide 106-131 of Natriuretic peptides B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "MVQGSGCFGRKMDRISSSSGLGCKVL" }, { "id": "bnp-4-30", "name": "BNP(4-30)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P16860", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P16860/entry", "note": "mature peptide 106-132 of Natriuretic peptides B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "MVQGSGCFGRKMDRISSSSGLGCKVLR" }, { "id": "bnp-4-31", "name": "BNP(4-31)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P16860", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P16860/entry", "note": "mature peptide 106-133 of Natriuretic peptides B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "MVQGSGCFGRKMDRISSSSGLGCKVLRR" }, { "id": "bnp-5-29", "name": "BNP(5-29)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P16860", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P16860/entry", "note": "mature peptide 107-131 of Natriuretic peptides B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "VQGSGCFGRKMDRISSSSGLGCKVL" }, { "id": "bnp-5-31", "name": "BNP(5-31)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P16860", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P16860/entry", "note": "mature peptide 107-133 of Natriuretic peptides B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "VQGSGCFGRKMDRISSSSGLGCKVLRR" }, { "id": "bnp-5-32", "name": "BNP(5-32)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P16860", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P16860/entry", "note": "mature peptide 107-134 of Natriuretic peptides B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "VQGSGCFGRKMDRISSSSGLGCKVLRRH" }, { "id": "bofanglutide", "name": "Bofanglutide", "synonyms": [ "Bofanglutida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068096", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068096/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "botulinum-toxin", "name": "Botulinum Toxin", "synonyms": [ "BoNT", "Botox", "Dysport", "Jeuveau", "Myobloc", "Xeomin", "abobotulinumtoxinA", "incobotulinumtoxinA", "onabotulinumtoxinA", "prabotulinumtoxinA", "rimabotulinumtoxinB" ], "moleculeClass": "protein", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 33040610", "url": "https://pubmed.ncbi.nlm.nih.gov/33040610/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "botulinum-toxin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "bpc-157", "name": "BPC-157", "synonyms": [ "Body Protective Compound 157", "PL 14736", "Pentadecapeptide BPC 157" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 30690000", "url": "https://pubmed.ncbi.nlm.nih.gov/30690000/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "bpc-157", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "bradykinin", "name": "Bradykinin", "synonyms": [ "BK", "Kallidin", "Kinin-9" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 8227859", "url": "https://pubmed.ncbi.nlm.nih.gov/8227859/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "bradykinin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "brain-natriuretic-peptide-29", "name": "Brain natriuretic peptide 29", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P16860", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P16860/entry", "note": "mature peptide 106-134 of Natriuretic peptides B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "MVQGSGCFGRKMDRISSSSGLGCKVLRRH" }, { "id": "brimapitide", "name": "Brimapitide", "synonyms": [ "Brimapitida", "Xg-102" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297650", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297650/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "brn2", "name": "BRN2 (POU3F2) Research Peptide", "synonyms": [ "N-Oct3 fragment", "POU3F2-derived peptide" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 11859196", "url": "https://pubmed.ncbi.nlm.nih.gov/11859196/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "brn2", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "bronchogen", "name": "Bronchogen", "synonyms": [ "AEDL", "Ala-Glu-Asp-Leu" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 23734519", "url": "https://pubmed.ncbi.nlm.nih.gov/23734519/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "bronchogen", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "bulevirtide", "name": "Bulevirtide", "synonyms": [ "915207G", "Bulevirtida", "Hepcludex", "Hepcludextm", "Myrcludex" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2020, "sources": [ { "type": "chembl", "id": "CHEMBL4297711", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297711/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL5315080", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5315080/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "bulevirtide", "gpMatch": "name", "innStem": "-tide; -vir-", "usanYear": 2021, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "buserelin", "name": "Buserelin", "synonyms": [ "Buserelin monoacetate", "Buserelina", "Busereline", "Conceptal", "HOE 766", "HOE-766", "NSC-725176", "Suprefact" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2110824", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2110824/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL2106198", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2106198/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "buserelin", "gpMatch": "name", "innStem": "-relin", "usanYear": 1979, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "c-flanking-peptide-of-npy", "name": "C-flanking peptide of NPY", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01303", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01303/entry", "note": "mature peptide 68-97 of Pro-neuropeptide Y" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "SSPETLISDLLMRESTENVPRTRLEDPAMW" }, { "id": "c-terminal-flanking-peptide", "name": "C-terminal-flanking peptide", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P20366", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P20366/entry", "note": "mature peptide 111-126 of Protachykinin-1" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "ALNSVAYERSAMQNYE" }, { "id": "c-terminal-peptide", "name": "C-terminal peptide", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P05408", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P05408/entry", "note": "mature peptide 200-212 of Neuroendocrine protein 7B2" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "SVPHFSDEDKDPE" }, { "id": "cagrilintide", "name": "Cagrilintide", "synonyms": [ "Cagrilintide component of cagrisema", "NNC0174-0833" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4802169", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4802169/", "read": "2026-10-02" } ], "gpEntry": "cagrilintide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2022, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "cagrisema", "name": "CagriSema", "synonyms": [ "NN9838", "cagrilintide/semaglutide 2.4/2.4" ], "moleculeClass": "blend", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 40544433", "url": "https://pubmed.ncbi.nlm.nih.gov/40544433/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "cagrisema", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "calcitonin", "name": "Calcitonin", "synonyms": [ "Miacalcin" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1986, "sources": [ { "type": "openfda", "id": "NDA017808", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=017808", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "calcitonin", "gpMatch": "alias", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "calcitonin-gene-related-peptide-2", "name": "Calcitonin gene-related peptide 2", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P10092", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P10092/entry", "note": "mature peptide 82-118 of Calcitonin gene-related peptide 2" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF" }, { "id": "calcitonin-human", "name": "Calcitonin (human)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01258", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01258/entry", "note": "mature peptide 85-116 of Calcitonin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP" }, { "id": "canvuparatide", "name": "Canvuparatide", "synonyms": [ "Canvuparatida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068219", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068219/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "capreomycin", "name": "Capreomycin", "synonyms": [ "Capastat", "Capostatin", "Capreomicin", "Capreomicina", "Capreomycine", "Capromycin" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1971, "sources": [ { "type": "chembl", "id": "CHEMBL2221250", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2221250/", "read": "2026-10-02" } ], "gpEntry": "capreomycin", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "capromab-pendetide", "name": "Capromab Pendetide", "synonyms": [ "CYT-356", "Oncoscint prostate", "Prostascint" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1996, "sources": [ { "type": "chembl", "id": "CHEMBL1201579", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1201579/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-mab; -tide", "usanYear": 1994, "chemblType": "Antibody", "helm": null, "sequence": null }, { "id": "capromorelin", "name": "Capromorelin", "synonyms": [ "CP-424,391", "CP-424,391-18", "CP-424391-18", "Capimorelin", "Capimorelin tartrate", "Capromorelina", "Capromoreline", "Cp-424,391", "Cp-424391", "Eluracat" ], "moleculeClass": "small-molecule", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL113313", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL113313/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL6068501", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068501/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "capromorelin", "gpMatch": "name", "innStem": "-relin", "usanYear": null, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "carbetocin", "name": "Carbetocin", "synonyms": [ "Carbetocina", "Carbetocine", "Duratocin", "Duratocin long acting", "FE 992097", "FE-992097", "LV-101", "Pabal" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3301668", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3301668/", "read": "2026-10-02" } ], "gpEntry": "carbetocin", "gpMatch": "name", "innStem": "-tocin", "usanYear": 2020, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "cardiogen", "name": "Cardiogen", "synonyms": [ "AEDR", "Ala-Glu-Asp-Arg" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 19830585", "url": "https://pubmed.ncbi.nlm.nih.gov/19830585/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "cardiogen", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "cargutocin", "name": "Cargutocin", "synonyms": [ "Cargutocina", "Cargutocine", "Statocin", "Y-5350" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2218869", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2218869/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tocin", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{[dN].[Asu].G.L.G.[am]}|PEPTIDE2{Y.I.[dQ]}$PEPTIDE2,PEPTIDE1,3:R2-1:R1|PEPTIDE1,PEPTIDE2,2:R3-1:R1$$$", "sequence": null }, { "id": "carnosine", "name": "Carnosine", "synonyms": [ "Beta-alanyl-L-histidine", "L-Carnosine" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 42308284", "url": "https://pubmed.ncbi.nlm.nih.gov/42308284/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "carnosine", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "carperitide", "name": "Carperitide", "synonyms": [ "Atrial natriuretic peptide", "Atrial natriuretic peptide carperitide", "Carperitida", "Hanp", "SUN 4936", "SUN-4936" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2104386", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2104386/", "read": "2026-10-02" }, { "type": "uniprot", "id": "P01160", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01160/entry", "note": "mature peptide 124-151 of Natriuretic peptides A" } ], "gpEntry": "carperitide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2004, "chemblType": "Protein", "helm": "PEPTIDE1{S.L.R.R.S.S.C.F.G.G.R.M.D.R.I.G.A.Q.S.G.L.G.C.N.S.F.R.Y}$PEPTIDE1,PEPTIDE1,23:R3-7:R3$$$", "sequence": null }, { "id": "cart-1-39", "name": "CART(1-39)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q16568", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q16568/entry", "note": "mature peptide 28-66 of Cocaine- and amphetamine-regulated transcript protein, 2 copies" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "QEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKS" }, { "id": "cart-42-89", "name": "CART(42-89)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q16568", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q16568/entry", "note": "mature peptide 69-116 of Cocaine- and amphetamine-regulated transcript protein, 2 copies" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL" }, { "id": "cartalax", "name": "Cartalax", "synonyms": [ "AED tripeptide", "Ala-Glu-Asp" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 23734519", "url": "https://pubmed.ncbi.nlm.nih.gov/23734519/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "cartalax", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "caspofungin", "name": "Caspofungin", "synonyms": [ "Cancidas" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2001, "sources": [ { "type": "openfda", "id": "NDA021227", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=021227", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "caspofungin", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "cathelicidin", "name": "Cathelicidin", "synonyms": [ "CAMP", "Cathelicidin Antimicrobial Peptide", "hCAP-18" ], "moleculeClass": "protein", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 35849644", "url": "https://pubmed.ncbi.nlm.nih.gov/35849644/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "cathelicidin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "cecropin", "name": "Cecropin", "synonyms": [ "Cecropin A", "Cecropin B", "Cecropin P1" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 7019715", "url": "https://pubmed.ncbi.nlm.nih.gov/7019715/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "cecropin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "cenderetide", "name": "Cenderetide", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": -1.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108582", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108582/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2010, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "cenderitide", "name": "Cenderitide", "synonyms": [ "CD-NP", "Cenderitida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108721", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108721/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2010, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "cerebrolysin", "name": "Cerebrolysin", "synonyms": [ "FPF-1070", "porcine brain peptide preparation" ], "moleculeClass": "blend", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 22282884", "url": "https://pubmed.ncbi.nlm.nih.gov/22282884/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "cerebrolysin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "cerluten", "name": "Cerluten", "synonyms": [ "Lung cytomedine", "Lung peptide bioregulator (Khavinson)" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 19830585", "url": "https://pubmed.ncbi.nlm.nih.gov/19830585/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "cerluten", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "certepetide", "name": "Certepetide", "synonyms": [ "CEND-1", "Certepetida", "LSTA-1", "LSTA1", "Lsta1" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5315026", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5315026/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2023, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "ceruletide", "name": "Ceruletide", "synonyms": [ "CERULETIDE DIETHYLAMINE", "Caerulein", "Caerulein diethylamine", "Ceosunin", "Cerulein", "Ceruletida", "Ceruletide diethylamine", "Ceruletide diethylamine salt", "Takus", "Tymtran" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1982, "sources": [ { "type": "chembl", "id": "CHEMBL1201355", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1201355/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL1200755", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1200755/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "ceruletide", "gpMatch": "name", "innStem": "-tide", "usanYear": 1980, "chemblType": "Protein", "helm": "PEPTIDE1{[Glp].Q.D.[X96].T.G.W.M.D.F.[am]}$$$$", "sequence": null }, { "id": "cetrorelix", "name": "Cetrorelix", "synonyms": [ "Cetrorelix (as acetate)", "Cetrotide", "Cetrotide acetate", "D-20761", "NS-75A", "SB-075 ACETATE" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1999, "sources": [ { "type": "chembl", "id": "CHEMBL1200490", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1200490/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL2103735", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2103735/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "cetrorelix", "gpMatch": "name", "innStem": "-relix", "usanYear": 2000, "chemblType": "Protein", "helm": "PEPTIDE1{[ac].[dNal].[dPhe(4-Cl)].[d3-Pal].S.Y.[dCit].L.R.P.[dA].[am]}$$$$", "sequence": null }, { "id": "cgrp", "name": "CGRP", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P06881", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P06881/entry", "note": "mature peptide 83-119 of Calcitonin gene-related peptide 1" } ], "gpEntry": "cgrp", "gpMatch": "sequence", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF" }, { "id": "cholecystokinin", "name": "Cholecystokinin", "synonyms": [ "Cck c-terminal octapeptide", "Cck-8", "Cck-8s", "Cholecystokinin c-terminal octapeptide", "Kinevac", "SQ 19844", "SQ-19844", "Sincalida", "Sincalide" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1976, "sources": [ { "type": "openfda", "id": "NDA017697", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=017697", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" }, { "type": "uniprot", "id": "P06307", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P06307/entry", "note": "mature peptide 96-103 of Cholecystokinin" }, { "type": "chembl", "id": "CHEMBL1121", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1121/", "read": "2026-10-02" } ], "gpEntry": "cholecystokinin", "gpMatch": "alias", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "DYMGWMDF" }, { "id": "cholecystokinin-12", "name": "Cholecystokinin-12", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P06307", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P06307/entry", "note": "mature peptide 92-103 of Cholecystokinin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "ISDRDYMGWMDF" }, { "id": "cholecystokinin-18", "name": "Cholecystokinin-18", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P06307", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P06307/entry", "note": "mature peptide 86-103 of Cholecystokinin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "LDPSHRISDRDYMGWMDF" }, { "id": "cholecystokinin-25", "name": "Cholecystokinin-25", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P06307", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P06307/entry", "note": "mature peptide 79-103 of Cholecystokinin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "IVKNLQNLDPSHRISDRDYMGWMDF" }, { "id": "cholecystokinin-33", "name": "Cholecystokinin-33", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P06307", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P06307/entry", "note": "mature peptide 71-103 of Cholecystokinin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "KAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF" }, { "id": "cholecystokinin-39", "name": "Cholecystokinin-39", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P06307", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P06307/entry", "note": "mature peptide 65-103 of Cholecystokinin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "YIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF" }, { "id": "cholecystokinin-5", "name": "Cholecystokinin-5", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P06307", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P06307/entry", "note": "mature peptide 99-103 of Cholecystokinin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "GWMDF" }, { "id": "cholecystokinin-58", "name": "Cholecystokinin-58", "synonyms": [], "moleculeClass": "protein", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P06307", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P06307/entry", "note": "mature peptide 46-103 of Cholecystokinin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "VSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF" }, { "id": "cholecystokinin-58-desnonopeptide", "name": "Cholecystokinin-58 desnonopeptide", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P06307", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P06307/entry", "note": "mature peptide 46-94 of Cholecystokinin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "VSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISD" }, { "id": "cholecystokinin-7", "name": "Cholecystokinin-7", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P06307", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P06307/entry", "note": "mature peptide 97-103 of Cholecystokinin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "YMGWMDF" }, { "id": "chonluten", "name": "Chonluten", "synonyms": [ "EDG tripeptide", "Glu-Asp-Gly" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 24003726", "url": "https://pubmed.ncbi.nlm.nih.gov/24003726/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "chonluten", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "cilengitide", "name": "Cilengitide", "synonyms": [ "Cilengitida", "EMD 121974", "EMD-12192", "EMD-121974" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL429876", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL429876/", "read": "2026-10-02" } ], "gpEntry": "cilengitide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2001, "chemblType": "Protein", "helm": "PEPTIDE1{[meV].R.G.D.[dF]}$PEPTIDE1,PEPTIDE1,5:R2-1:R1$$$", "sequence": null }, { "id": "cjc-1295", "name": "CJC-1295", "synonyms": [ "CJC-1295 DAC", "CJC-1295 with DAC", "DAC:GRF", "Drug Affinity Complex:GRF" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 16352683", "url": "https://pubmed.ncbi.nlm.nih.gov/16352683/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "cjc-1295", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "cnp", "name": "CNP", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P23582", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P23582/entry", "note": "mature peptide 105-126 of C-type natriuretic peptide" } ], "gpEntry": "cnp", "gpMatch": "sequence", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "GLSKGCFGLKLDRIGSMSGLGC" }, { "id": "cnp-29", "name": "CNP-29", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P23582", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P23582/entry", "note": "mature peptide 98-126 of C-type natriuretic peptide" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "YKGANKKGLSKGCFGLKLDRIGSMSGLGC" }, { "id": "cnp-53", "name": "CNP-53", "synonyms": [], "moleculeClass": "protein", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P23582", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P23582/entry", "note": "mature peptide 74-126 of C-type natriuretic peptide" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC" }, { "id": "codactide", "name": "Codactide", "synonyms": [ "BA-41795", "Codactida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2104378", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2104378/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{[dS].Y.S.[dM].E.[dH].[dF].R.W.G.[dK].P.V.G.K.[dK].K.[dK].[am]}$$$$", "sequence": null }, { "id": "colistin", "name": "Colistin", "synonyms": [ "Coly-Mycin M" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1970, "sources": [ { "type": "openfda", "id": "NDA050108", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=050108", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "colistin", "gpMatch": "alias", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "collagen-peptides", "name": "Collagen Peptides", "synonyms": [ "Collagen Hydrolysate", "Collagen Protein", "Hydrolyzed Collagen" ], "moleculeClass": "blend", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 33742704", "url": "https://pubmed.ncbi.nlm.nih.gov/33742704/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "collagen-peptides", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "colostrinin", "name": "Colostrinin", "synonyms": [ "CLN", "PRP", "Proline-Rich Polypeptide Complex" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 10608295", "url": "https://pubmed.ncbi.nlm.nih.gov/10608295/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "colostrinin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "colulintide", "name": "Colulintide", "synonyms": [ "LY-3541105", "LY3541105", "Ly3541105" ], "moleculeClass": "peptide", "status": "phase-1", "maxPhase": 1.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068472", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068472/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2024, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "copeptin", "name": "Copeptin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01185", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01185/entry", "note": "mature peptide 126-164 of Vasopressin-neurophysin 2-copeptin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY" }, { "id": "copper-64cu-adarulatide-tetraxetan", "name": "Copper (64cu) Adarulatide Tetraxetan", "synonyms": [ "Cobre (64cu) adarulatida tetraxetan", "Cuivre (64cu) adarulatide tetraxetan" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068105", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068105/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide; -xetan", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "copper-oxodotreotide", "name": "Copper Cu 64 dotatate", "synonyms": [ "64cu-dotatate", "COPPER OXODOTREOTIDE CU-64", "Copper (64cu) dotatate", "Copper 64-dota-tate", "Copper cu-64 dotatate", "Copper dotatate cu-64", "Copper oxodotreotide cu-64", "Detectnet" ], "moleculeClass": "peptide-conjugate", "status": "approved", "maxPhase": 4.0, "firstApproval": 2020, "sources": [ { "type": "chembl", "id": "CHEMBL4302413", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4302413/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL4297339", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297339/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "copper-oxodotreotide", "gpMatch": "name", "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "corifollitropin-alfa", "name": "Corifollitropin alfa", "synonyms": [ "Elonva", "FSH-CTP" ], "moleculeClass": "protein", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 26003273", "url": "https://pubmed.ncbi.nlm.nih.gov/26003273/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "corifollitropin-alfa", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "cortagen", "name": "Cortagen", "synonyms": [ "AEDP", "Ala-Glu-Asp-Pro", "Cortexin peptide" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 12374906", "url": "https://pubmed.ncbi.nlm.nih.gov/12374906/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "cortagen", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "corticorelin", "name": "Corticorelin", "synonyms": [ "Acthrel", "Corticoliberin human", "Corticorelin (human)", "Corticorelin acetate human", "Corticorelin human", "Corticorelina", "Corticoreline", "Corticotropin-releasing factor", "Corticotropin-releasing hormone", "Crf", "Human corticoliberin", "NEU 3002", "NEU-3002", "NEU-3002 ACETATE", "Xerecept" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1996, "sources": [ { "type": "chembl", "id": "CHEMBL1201591", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1201591/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL2107324", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2107324/", "read": "2026-10-02", "note": "separate ChEMBL record of the same molecule" }, { "type": "chembl", "id": "CHEMBL2108182", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108182/", "read": "2026-10-02", "note": "separate ChEMBL record of the same molecule" }, { "type": "uniprot", "id": "P06850", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P06850/entry", "note": "mature peptide 154-194 of Corticotropin-releasing hormone" } ], "gpEntry": "corticorelin", "gpMatch": "alias", "innStem": "-relin; -vin-", "usanYear": 1990, "chemblType": "Protein", "helm": "PEPTIDE1{S.E.E.P.P.I.S.L.D.L.T.F.H.L.L.R.E.V.L.E.M.A.R.A.E.Q.L.A.Q.Q.A.H.S.N.R.K.L.M.E.I.I.[am]}$$$$", "sequence": null }, { "id": "corticotropin", "name": "Corticotropin", "synonyms": [ "Acthar Gel", "Acthar Gel (Autoinjector)", "Purified Cortrophin Gel" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1952, "sources": [ { "type": "openfda", "id": "NDA008372", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=008372", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "corticotropin", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "corticotropin-human", "name": "Corticotropin (human)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01189", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01189/entry", "note": "mature peptide 138-176 of Pro-opiomelanocortin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF" }, { "id": "corticotropin-like-intermediary-peptide", "name": "Corticotropin-like intermediary peptide", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01189", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01189/entry", "note": "mature peptide 156-176 of Pro-opiomelanocortin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "PVKVYPNGAEDESAEAFPLEF" }, { "id": "cortistatin-14", "name": "Cortistatin-14", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "O00230", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/O00230/entry", "note": "mature peptide 92-105 of Cortistatin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "PCRNFFWKTFSSCK" }, { "id": "cortistatin-17", "name": "Cortistatin-17", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "O00230", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/O00230/entry", "note": "mature peptide 89-105 of Cortistatin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "DRMPCRNFFWKTFSSCK" }, { "id": "cortistatin-29", "name": "Cortistatin-29", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "O00230", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/O00230/entry", "note": "mature peptide 77-105 of Cortistatin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "QEGAPPQQSARRDRMPCRNFFWKTFSSCK" }, { "id": "cotadutide", "name": "Cotadutide", "synonyms": [ "Cotadutida", "MEDI-0382", "MEDI0382", "Medi 0382", "Medi0382" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297630", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297630/", "read": "2026-10-02" } ], "gpEntry": "cotadutide", "gpMatch": "name", "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "cyclosporine", "name": "Cyclosporine", "synonyms": [ "Cequa", "Neoral", "Restasis", "Restasis Multidose", "Sandimmune", "Verkazia", "Vevye" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1983, "sources": [ { "type": "openfda", "id": "NDA050573", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=050573", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "cyclosporine", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "dalazatide", "name": "Dalazatide", "synonyms": [ "Dalazatida", "SHK-186", "SHK186" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297738", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297738/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "dalbavancin", "name": "Dalbavancin", "synonyms": [ "Dalvance" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2014, "sources": [ { "type": "openfda", "id": "NDA021883", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=021883", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "dalbavancin", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "danegaptide", "name": "Danegaptide", "synonyms": [ "Danegaptida", "GAP-134", "ZP-1609", "ZP1609" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL560592", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL560592/", "read": "2026-10-02" } ], "gpEntry": "danegaptide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2008, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "danuglipron", "name": "Danuglipron", "synonyms": [ "PF-06882961" ], "moleculeClass": "small-molecule", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "clinicaltrials", "id": "NCT04707313", "url": "https://clinicaltrials.gov/study/NCT04707313", "read": "2026-10-02", "note": "trial registration cited on the encyclopedia entry" } ], "gpEntry": "danuglipron", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "dapiglutide", "name": "Dapiglutide", "synonyms": [], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314980", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314980/", "read": "2026-10-02" } ], "gpEntry": "dapiglutide", "gpMatch": "name", "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "daptomycin", "name": "Daptomycin", "synonyms": [], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2017, "sources": [ { "type": "openfda", "id": "NDA208385", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=208385", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "daptomycin", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "dasiglucagon", "name": "Dasiglucagon", "synonyms": [ "ZP-4207", "ZP-GA-1", "ZP4207", "Zegalogue", "Zegalogue (Autoinjector)" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2021, "sources": [ { "type": "openfda", "id": "NDA214231", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=214231", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" }, { "type": "chembl", "id": "CHEMBL4297741", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297741/", "read": "2026-10-02" } ], "gpEntry": "dasiglucagon", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "davalintide", "name": "Davalintide", "synonyms": [ "AC-2307", "AC2307", "Ac2307", "Davalintida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2105635", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2105635/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL2105636", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2105636/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2008, "chemblType": "Protein", "helm": "PEPTIDE1{K.C.N.[lalloT].A.[lalloT].C.V.L.G.R.L.S.Q.E.L.H.R.L.[dQ].[lalloT].Y.P.R.[lalloT].N.T.G.S.N.T.Y.[am]}$PEPTIDE1,PEPTIDE1,7:R3-2:R3$$$", "sequence": null }, { "id": "davunetide", "name": "Davunetide", "synonyms": [ "AL-108", "AL-208", "Davunetida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2103826", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2103826/", "read": "2026-10-02" } ], "gpEntry": "davunetide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2008, "chemblType": "Protein", "helm": "PEPTIDE1{N.A.P.V.S.I.P.Q}$$$$", "sequence": null }, { "id": "dazdotuftide", "name": "Dazdotuftide", "synonyms": [ "Dazdotuftida", "TRS-01", "TRS01" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5095261", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5095261/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "decorinyl", "name": "Decorinyl", "synonyms": [ "Decorin-mimetic peptide", "Lys-Asp-Ile-Cit-NH2", "T10-C", "Tripeptide-10 Citrulline" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 18377618", "url": "https://pubmed.ncbi.nlm.nih.gov/18377618/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "decorinyl", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "degarelix", "name": "Degarelix", "synonyms": [ "Degarelix (as acetate)", "Degarelix accord", "FE-200486", "FE200486", "FE200486 (AS ACETATE SALT)", "FE200486 (FREE BASE)", "Firmagon" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2008, "sources": [ { "type": "chembl", "id": "CHEMBL415606", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL415606/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL2028987", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2028987/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "degarelix", "gpMatch": "name", "innStem": "-relix", "usanYear": 2007, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "delmitide", "name": "Delmitide", "synonyms": [ "Delmitida", "RSP-58", "RSP58" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108587", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108587/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL2108588", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108588/", "read": "2026-10-02", "note": "separate ChEMBL record of the same molecule" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "demoxytocin", "name": "Demoxytocin", "synonyms": [ "1-deaminooxytocin", "Deaminooxytocin", "Demoxitocina", "Demoxytocine", "Desaminooxytocin", "ODA 914", "ODA-914", "Oxytocin, deamino-", "Sandopart" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL435716", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL435716/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tocin", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "depreotide", "name": "Depreotide", "synonyms": [ "Depreotida", "Neospect", "P-829", "P829" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2000, "sources": [ { "type": "chembl", "id": "CHEMBL1908335", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1908335/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL5315079", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5315079/", "read": "2026-10-02", "note": "separate ChEMBL record of the same molecule" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 1998, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "dermcidin", "name": "Dermcidin", "synonyms": [ "DCD", "DCD-1L", "Sweat antimicrobial peptide" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 11694882", "url": "https://pubmed.ncbi.nlm.nih.gov/11694882/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "dermcidin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "dermorphin", "name": "Dermorphin", "synonyms": [ "Phyllomedusa opioid peptide", "[D-Ala2]-dermorphin" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 2544892", "url": "https://pubmed.ncbi.nlm.nih.gov/2544892/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "dermorphin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "deslorelin", "name": "Deslorelin", "synonyms": [ "D-TRP LHRH-PEA", "D-TRP-LHRH-PEA", "Deslorelina", "Desloreline", "Suprelorin" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2365665", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2365665/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL2357192", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2357192/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": null, "gpMatch": null, "innStem": "-relin", "usanYear": 1989, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "desmopressin", "name": "Desmopressin", "synonyms": [ "Anhydrous desmopressin acetate", "Concentraid", "Ddavp", "Ddavp (needs no refrigeration)", "Desmomelt", "Desmopresina", "Desmopressin acetate (needs no refrigeration)", "Desmopressin acetate anhydrous", "Desmopressin acetate preservative free", "Desmopressine", "Desmospray", "Desmotabs", "H01BA02", "Minirin", "Nocdurna", "Noctiva", "Nocutil", "Noqdirna", "Octim", "Octostim", "Presinex", "Ser-120", "Ser120", "Stimate", "Stimate (needs no refrigeration)" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1978, "sources": [ { "type": "chembl", "id": "CHEMBL1429", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1429/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL1200556", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1200556/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "desmopressin", "gpMatch": "name", "innStem": "-pressin", "usanYear": 1977, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "detirelix", "name": "Detirelix", "synonyms": [ "RS-68439" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2106408", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2106408/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-relix", "usanYear": 1987, "chemblType": "Protein", "helm": "PEPTIDE1{[ac].[dNal].[Phe(4-Cl)].W.S.Y.[X17].L.R.P.[dA].[am]}$$$$", "sequence": null }, { "id": "diamfenetide", "name": "Diamfenetide", "synonyms": [ "COMPOUND 68-198", "COMPOUND-68-198", "Diamfenetida", "NSC-291838" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2104259", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2104259/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "diclometide", "name": "Diclometide", "synonyms": [ "Diclometida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2106106", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2106106/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "difelikefalin", "name": "Difelikefalin", "synonyms": [ "Korsuva" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2021, "sources": [ { "type": "openfda", "id": "NDA214916", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=214916", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "difelikefalin", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "dihexa", "name": "Dihexa", "synonyms": [ "N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide", "PNB-0408" ], "moleculeClass": "peptidomimetic", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 34827486", "url": "https://pubmed.ncbi.nlm.nih.gov/34827486/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "dihexa", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "dipeptide-2", "name": "Dipeptide-2", "synonyms": [ "Valyltryptophan" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 168182", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/168182", "read": "2026-10-02", "note": "PubChem title: Valyltryptophan" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "dirucotide", "name": "Dirucotide", "synonyms": [ "Dirucotida", "MBP-8298", "MBP8298", "MBP8298 PEPTIDE", "SF-328", "SF328" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2105639", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2105639/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL2105640", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2105640/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "dirucotide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2008, "chemblType": "Protein", "helm": "PEPTIDE1{D.E.N.P.V.V.H.F.F.K.N.[dalloI].V.T.P.R.T}$$$$", "sequence": null }, { "id": "disaccharide-tripeptide-glycerol-dipalmitoyl", "name": "Disaccharide Tripeptide Glycerol Dipalmitoyl", "synonyms": [ "Dtp-gdp", "Immther" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297391", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297391/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "disitertide", "name": "Disitertide", "synonyms": [ "Disitertida", "P-144", "P144", "Peptide 144 tgf beta-1-inhibitor" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108346", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108346/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "disomotide", "name": "Disomotide", "synonyms": [ "Disomotida", "Gp-100:209-217(210m) peptide", "Gp100:209-217(210m) peptide", "MPS-22" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL263429", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL263429/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2005, "chemblType": "Protein", "helm": "PEPTIDE1{I.M.D.Q.V.P.F.S.V}$$$$", "sequence": null }, { "id": "dolcanatide", "name": "Dolcanatide", "synonyms": [ "Dolcanatida", "SP-333" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3545122", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3545122/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2015, "chemblType": "Protein", "helm": "PEPTIDE1{[dN].D.E.C.E.L.C.V}|PEPTIDE2{N.V.A.C.T.G.C.[dL]}$PEPTIDE2,PEPTIDE1,4:R3-4:R3|PEPTIDE2,PEPTIDE1,7:R3-7:R3$$$", "sequence": null }, { "id": "doreptide", "name": "Doreptide", "synonyms": [ "Doreptida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2109123", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2109123/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "dsip", "name": "DSIP", "synonyms": [ "Delta sleep inducing peptide", "Delta sleep-inducing peptide", "Dsip", "Emideltida", "Trp-ala-gly-gly-asp-ala-ser-gly-glu" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2104403", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2104403/", "read": "2026-10-02" } ], "gpEntry": "dsip", "gpMatch": "alias", "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{W.A.G.G.D.A.S.G.E}$$$$", "sequence": null }, { "id": "dulaglutide", "name": "Dulaglutide", "synonyms": [ "Dulaglutida", "Dulaglutide component of trulicity", "LY-2189265", "LY2189265", "Trulicity" ], "moleculeClass": "protein", "status": "approved", "maxPhase": 4.0, "firstApproval": 2014, "sources": [ { "type": "chembl", "id": "CHEMBL2108027", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108027/", "read": "2026-10-02" } ], "gpEntry": "dulaglutide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2009, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "dumorelin", "name": "Dumorelin", "synonyms": [ "Dumorelina", "Dumoreline" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108374", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108374/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-relin", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "dusquetide", "name": "Dusquetide", "synonyms": [ "Arg-ile-val-pro-ala-nh2", "Dusquetida", "IMX-942", "SGX-94", "SGX-942", "SGX94", "SGX942", "Sgx942" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3545314", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3545314/", "read": "2026-10-02" } ], "gpEntry": "dusquetide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2014, "chemblType": "Protein", "helm": "PEPTIDE1{R.I.V.P.A.[am]}$$$$", "sequence": null }, { "id": "dynorphin", "name": "Dynorphin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01213", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01213/entry", "note": "mature peptide 207-238 of Proenkephalin-B" } ], "gpEntry": "dynorphin", "gpMatch": "alias", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "YGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVT" }, { "id": "dynorphin-a-1-13", "name": "Dynorphin A(1-13)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01213", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01213/entry", "note": "mature peptide 207-219 of Proenkephalin-B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "YGGFLRRIRPKLK" }, { "id": "dynorphin-a-1-8", "name": "Dynorphin A(1-8)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01213", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01213/entry", "note": "mature peptide 207-214 of Proenkephalin-B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "YGGFLRRI" }, { "id": "early-placenta-insulin-like-peptide-a-chain", "name": "Early placenta insulin-like peptide A chain", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q14641", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q14641/entry", "note": "mature peptide 115-139 of Early placenta insulin-like peptide" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "SGRHRFDPFCCEVICDDGTSVKLCT" }, { "id": "early-placenta-insulin-like-peptide-b-chain", "name": "Early placenta insulin-like peptide B chain", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q14641", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q14641/entry", "note": "mature peptide 26-58 of Early placenta insulin-like peptide" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWL" }, { "id": "ebiratide", "name": "Ebiratide", "synonyms": [ "Ebiratida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2106396", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2106396/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "ecallantide", "name": "Ecallantide", "synonyms": [ "DX-88", "Ecalantida", "Escallantide" ], "moleculeClass": "protein", "status": "approved", "maxPhase": 4.0, "firstApproval": 2009, "sources": [ { "type": "chembl", "id": "CHEMBL1201837", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1201837/", "read": "2026-10-02" } ], "gpEntry": "ecallantide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2005, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "ecc5004", "name": "ECC5004", "synonyms": [ "AZD5004", "elecoglipron" ], "moleculeClass": "small-molecule", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 39495140", "url": "https://pubmed.ncbi.nlm.nih.gov/39495140/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "ecc5004", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "ecnoglutide", "name": "Ecnoglutide", "synonyms": [ "Ecnoglutida", "Ecnoglutide component of xw-004", "Ecnoglutide component of xw004 xw003", "XW-003", "Xw003" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5095115", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5095115/", "read": "2026-10-02" } ], "gpEntry": "ecnoglutide", "gpMatch": "name", "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "ederimotide", "name": "Ederimotide", "synonyms": [ "Ederimotida", "Wt-1 a1", "Wt1-a1" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314734", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314734/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "edotreotide", "name": "Edotreotide", "synonyms": [ "Dotatoc", "Edotreotida", "SMT 487", "SMT-487", "SMT487" ], "moleculeClass": "peptide-conjugate", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL408350", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL408350/", "read": "2026-10-02" } ], "gpEntry": "edotreotide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2002, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "edotreotide-yttrium", "name": "Edotreotide Yttrium", "synonyms": [ "90Y-SMT-487", "90y-dota-tyr3-octreotide", "90y-dotatoc", "90ydotatoc", "Dotatoc yttrium y-90", "EDOTREOTIDE YTTRIUM Y-90", "Edotreotide 90y chelate", "Edotreotide yttrium y-90", "SMT-487 Y-90", "Y-90 dota-tyr(3)-octreotide", "Yttrium (90 y) dotatoc", "Yttrium (90y) edotreotide", "Yttrium y 90-dota-tyr3-octreotide", "Yttrium y 90-edotreotide" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL386768", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL386768/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL4297342", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297342/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "edratide", "name": "Edratide", "synonyms": [ "Edratida", "TV-4710" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2107743", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2107743/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2004, "chemblType": "Protein", "helm": "PEPTIDE1{G.Y.Y.W.[Abu].W.I.R.Q.P.P.G.K.G.E.E.W.I.G}$$$$", "sequence": null }, { "id": "efinopegdutide", "name": "Efinopegdutide", "synonyms": [ "Efinopegdutida", "HM-12525A", "HM12525A", "JNJ-64565111", "Jnj-64565111" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297576", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297576/", "read": "2026-10-02" } ], "gpEntry": "efinopegdutide", "gpMatch": "name", "innStem": "ef-; -peg-; -tide", "usanYear": 2019, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "efmedaglutide-alfa", "name": "Efmedaglutide Alfa", "synonyms": [ "Efmedaglutida alfa" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068240", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068240/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "ef-; -tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "efocipegtrutide", "name": "Efocipegtrutide", "synonyms": [ "Efocipegtrutida" ], "moleculeClass": "peptide-conjugate", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5095149", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5095149/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "ef-; -peg-; -tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "efpeglenatide", "name": "Efpeglenatide", "synonyms": [ "HM-11260C", "HM11260C", "Hm11260c", "Langlenatide", "SAR-439977", "SAR439977" ], "moleculeClass": "peptide-conjugate", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4650470", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4650470/", "read": "2026-10-02" } ], "gpEntry": "efpeglenatide", "gpMatch": "name", "innStem": "ef-; -peg-; -tide", "usanYear": 2020, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "efsubaglutide-alfa", "name": "Efsubaglutide Alfa", "synonyms": [ "Efsubaglutida alfa" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068241", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068241/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "ef-; -tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "elagolix", "name": "Elagolix", "synonyms": [ "NBI-56418", "Orilissa" ], "moleculeClass": "small-molecule", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 28525302", "url": "https://pubmed.ncbi.nlm.nih.gov/28525302/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "elagolix", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "elcatonin", "name": "Elcatonin", "synonyms": [ "Elcatonina", "Elcatonine" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2104402", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2104402/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{S.N.L.S}|PEPTIDE2{T.[Asu].V.L.G.K.L.S.Q.E.L.H.K.L.Q.T.Y.P.R.T.D.V.G.A.G.T.P.[am]}$PEPTIDE2,PEPTIDE1,2:R3-1:R1|PEPTIDE1,PEPTIDE2,4:R2-1:R1$$$", "sequence": null }, { "id": "eloralintide", "name": "Eloralintide", "synonyms": [ "AMY-1176", "AMY1176", "Eloralintida", "LY-3841136", "LY3841136", "Ly3841136" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068462", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068462/", "read": "2026-10-02" } ], "gpEntry": "eloralintide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2024, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "elpamotide", "name": "Elpamotide", "synonyms": [ "Elpamotida", "VEGFR2-169", "Vegfr2-169 peptide vaccine" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108295", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108295/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "elsiglutide", "name": "Elsiglutide", "synonyms": [ "Elsiglutida", "ZP-1846", "ZP1846", "Zp1846" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108318", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108318/", "read": "2026-10-02" } ], "gpEntry": "elsiglutide", "gpMatch": "name", "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "enavermotide", "name": "Enavermotide", "synonyms": [ "Enavermotida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314828", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314828/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "endoluten", "name": "Endoluten", "synonyms": [ "A-8 (pineal peptide preparation)", "Pineal peptide bioregulator" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 19830585", "url": "https://pubmed.ncbi.nlm.nih.gov/19830585/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "endoluten", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "endomorphin-1", "name": "Endomorphin-1", "synonyms": [], "moleculeClass": "peptide", "status": "preclinical", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL316446", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL316446/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{Y.P.W.F.[am]}$$$$", "sequence": null }, { "id": "endothelin-1", "name": "Endothelin-1", "synonyms": [ "ET-1", "Endothelin" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 9279213", "url": "https://pubmed.ncbi.nlm.nih.gov/9279213/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "endothelin-1", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "eneboparatide", "name": "Eneboparatide", "synonyms": [ "AZP-3601", "AZP3601", "Eneboparatida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5095311", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5095311/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2023, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "enfuvirtide", "name": "Enfuvirtide", "synonyms": [ "DP-178", "DP178", "Enfuvirtida", "Fuzeon", "Fuzeon t-20", "Pentafuside (trivial name)", "T-20", "T20" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2003, "sources": [ { "type": "chembl", "id": "CHEMBL525076", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL525076/", "read": "2026-10-02" } ], "gpEntry": "enfuvirtide", "gpMatch": "name", "innStem": "-tide; -vir-", "usanYear": 2001, "chemblType": "Protein", "helm": "PEPTIDE1{[ac].Y.T.S.L.I.H.S.L.I.E.E.S.Q.N.Q.Q.E.K.N.E.Q.E.L.L.E.L.D.K.W.A.S.L.W.N.W.F.[am]}$$$$", "sequence": null }, { "id": "enkephalin", "name": "Enkephalin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01210", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01210/entry", "note": "mature peptide 230-234 of Proenkephalin-A, 4 copies" } ], "gpEntry": "enkephalin", "gpMatch": "alias", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "YGGFL" }, { "id": "enlicitide", "name": "Enlicitide", "synonyms": [ "Chlorure d'enlicitide", "Chloruro de enlicitida", "ENLICITIDE DECANOATE", "Enlicitide decanoate", "MK-0616", "Mk-0616" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068773", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068773/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL6067978", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6067978/", "read": "2026-10-02", "note": "salt form, folded into this row" }, { "type": "chembl", "id": "CHEMBL6068420", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068420/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "enlicitide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2024, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "ensereptide", "name": "Ensereptide", "synonyms": [ "PXL-01", "PXL01" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5095372", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5095372/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "epithalon", "name": "Epithalon", "synonyms": [ "AEDG", "Epitalon", "Epithalamin" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 12937682", "url": "https://pubmed.ncbi.nlm.nih.gov/12937682/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "epithalon", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "eptifibatide", "name": "Eptifibatide", "synonyms": [ "Eptifibatida", "Eptifibatide accord", "Integrelin", "Integrilin" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1998, "sources": [ { "type": "chembl", "id": "CHEMBL1174", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1174/", "read": "2026-10-02" } ], "gpEntry": "eptifibatide", "gpMatch": "name", "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "erythropoietin", "name": "Erythropoietin (EPO)", "synonyms": [ "Aranesp", "Darbepoetin alfa", "EPO", "Epoetin alfa", "Epoetin beta", "Epogen", "Procrit", "rHuEPO", "rhEpo" ], "moleculeClass": "protein", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 24273483", "url": "https://pubmed.ncbi.nlm.nih.gov/24273483/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "erythropoietin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "etarfolatide", "name": "Etarfolatide", "synonyms": [ "EC-20" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297280", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297280/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "etelcalcetide", "name": "Etelcalcetide", "synonyms": [ "AMG 416", "Etelcalcetida", "KAI-4169", "KAI-4169 HCl", "KAI-4169 HYDROCHLORIDE", "ONO-5163", "Parsabiv", "Telcalcetide", "Telcalcetide hydrochloride", "Velcalcetide", "Velcalcetide hydrochloride" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2016, "sources": [ { "type": "chembl", "id": "CHEMBL3545184", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3545184/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL3545183", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3545183/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "etelcalcetide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2012, "chemblType": "Protein", "helm": "PEPTIDE1{[ac].[dC].[dA].[dR].[dR].[dR].[dA].[dR].[am]}|PEPTIDE2{C}$PEPTIDE2,PEPTIDE1,1:R3-2:R3$$$", "sequence": null }, { "id": "etimumotide", "name": "Etimumotide", "synonyms": [ "Etimumotida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314741", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314741/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "exenatide", "name": "Exenatide", "synonyms": [ "AC 2993", "AC-002993", "AC-2993", "AC-2993A", "AC-2993LAR", "AC002993", "AC2993", "AC2993A", "Bydureon", "Bydureon bcise", "Bydureon pen", "Byetta", "DA-3091", "EXENDIN-4", "Exenatida", "Exenatide synthetic", "Exendin 4", "ITCA-650", "LY-2148568", "LY2148568" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2005, "sources": [ { "type": "chembl", "id": "CHEMBL414357", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL414357/", "read": "2026-10-02" } ], "gpEntry": "exenatide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2003, "chemblType": "Protein", "helm": "PEPTIDE1{H.G.E.G.T.F.T.S.D.L.S.K.Q.M.E.E.E.A.V.R.L.F.I.E.W.L.K.N.G.G.P.S.S.G.A.P.P.P.S.[am]}$$$$", "sequence": null }, { "id": "felypressin", "name": "Felypressin", "synonyms": [ "Felipresina", "Felypressine", "PLV-2" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3185126", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3185126/", "read": "2026-10-02" } ], "gpEntry": "felypressin", "gpMatch": "name", "innStem": "-pressin", "usanYear": 1965, "chemblType": "Protein", "helm": "PEPTIDE1{C.F.F.Q.N.C.P.K.G.[am]}$PEPTIDE1,PEPTIDE1,6:R3-1:R3$$$", "sequence": null }, { "id": "fequesetide", "name": "Fequesetide", "synonyms": [ "Fequesetida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314679", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314679/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "fertirelin", "name": "Fertirelin", "synonyms": [ "Conceral", "Fertirelina", "Fertireline", "Ovalyse", "TAP 031", "TAP 031 (AS THE BASE)", "TAP 031 ACETATE", "TAP-031", "TAP-031 ACETATE", "U-69689E" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3272563", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3272563/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL3989593", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3989593/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": null, "gpMatch": null, "innStem": "-relin", "usanYear": 1988, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "fexapotide", "name": "Fexapotide", "synonyms": [ "FEXAPOTIDE TRIFLUTATE", "Fexapotida", "Fexapotide triflutate", "NX-1207", "NX-1207 TRIFLUOROACETATE", "NYM-4805", "NYM4805" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3545061", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3545061/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL3707309", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3707309/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "fexapotide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2015, "chemblType": "Protein", "helm": "PEPTIDE1{I.D.Q.Q.V.L.S.R.I.K.L.E.I.K.R.C.L}$$$$", "sequence": null }, { "id": "fgl-peptide", "name": "FGL Peptide", "synonyms": [ "EVYVVAENQQGKSKA", "FGL", "NCAM-derived FGL peptide" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 15525346", "url": "https://pubmed.ncbi.nlm.nih.gov/15525346/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "fgl-peptide", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "fk-13", "name": "FK-13", "synonyms": [ "FKRIVQRIKDFLR", "LL-37 central fragment", "LL-37(17-29)" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 16637646", "url": "https://pubmed.ncbi.nlm.nih.gov/16637646/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "fk-13", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "flavin-adenin-dinucleotide", "name": "Flavin Adenin Dinucleotide", "synonyms": [ "Adenine-riboflavin dinucleotide", "Fad", "Flavin adenine dinucleotide", "Flavin-adenine dinucleotide", "Flavine adenine dinucleotide", "Flavine adenosine diphosphate", "Flavine-adenine dinucleotide", "NSC-112207" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": -1.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL1232653", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1232653/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "fluciclatide", "name": "Fluciclatide", "synonyms": [ "(18F)AH-111585", "(18F)AH111585", "AH-111585", "AH-111585 (18F)", "AH-111585 F-18", "FLUCICLATIDE F 18", "Fluciclatida (18f)", "Fluciclatide (18f)", "Fluciclatide (f-18)", "Fluciclatide f 18", "Fluciclatide f-18", "[18F]AH111585" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3990277", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3990277/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL3989518", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3989518/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2010, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "follistatin-315", "name": "Follistatin-315", "synonyms": [ "FS-315" ], "moleculeClass": "protein", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 8340384", "url": "https://pubmed.ncbi.nlm.nih.gov/8340384/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "follistatin-315", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "follistatin-344", "name": "Follistatin-344", "synonyms": [ "FS-344" ], "moleculeClass": "protein", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 25322757", "url": "https://pubmed.ncbi.nlm.nih.gov/25322757/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "follistatin-344", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "follitropin-alfa", "name": "Follitropin alfa", "synonyms": [ "Gonal-F RFF", "Gonal-F RFF Redi-ject", "Gonal-f", "rFSH alfa" ], "moleculeClass": "protein", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 8822421", "url": "https://pubmed.ncbi.nlm.nih.gov/8822421/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "follitropin-alfa", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "follitropin-beta", "name": "Follitropin beta", "synonyms": [ "Follistim", "Follistim AQ", "Puregon", "rFSH beta" ], "moleculeClass": "protein", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 8567765", "url": "https://pubmed.ncbi.nlm.nih.gov/8567765/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "follitropin-beta", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "follitropin-delta", "name": "Follitropin delta", "synonyms": [ "FE 999049", "Rekovelle" ], "moleculeClass": "protein", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 34179971", "url": "https://pubmed.ncbi.nlm.nih.gov/34179971/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "follitropin-delta", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "foxo4-dri", "name": "FOXO4-DRI", "synonyms": [ "FOXO4-p53 interfering peptide" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 28340339", "url": "https://pubmed.ncbi.nlm.nih.gov/28340339/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "foxo4-dri", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "froniglutide", "name": "Froniglutide", "synonyms": [ "Glymera", "PB-1023", "PB1023", "PF-1801", "PF1801" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314983", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314983/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "fulipiftide", "name": "Fulipiftide", "synonyms": [ "BR21001" ], "moleculeClass": "peptide", "status": "phase-1", "maxPhase": 1.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068486", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068486/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2024, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "galanin", "name": "Galanin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P22466", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P22466/entry", "note": "mature peptide 33-62 of Galanin peptides" } ], "gpEntry": "galanin", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS" }, { "id": "galanin-message-associated-peptide", "name": "Galanin message-associated peptide", "synonyms": [], "moleculeClass": "protein", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P22466", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P22466/entry", "note": "mature peptide 65-123 of Galanin peptides" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "ELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS" }, { "id": "gallium-oxodotreotide", "name": "Gallium Ga 68 dotatate", "synonyms": [ "(68ga)gallium dotatate", "68ga-dota-tyr3-octreotide", "68ga-dotatate", "68ga-dotatoc", "Dota-octreotate gallium ga-68", "Dota-toc gallium ga-68", "Dotatate gallium ga-68", "EDOTREOTIDE GALLIUM GA-68", "Edotreotide gallium ga 68", "Edotreotide gallium ga-68", "Ga 68 dotatoc", "Ga-68 dota-tyr3-octreotide", "Ga-68-dotatoc", "Galiomedix", "Gallium (68ga) dota-tate", "Gallium (68ga) dotatate", "Gallium (68ga) edotreotide", "Gallium (ga68) dotatate", "Gallium 68 dotatate", "Gallium dotatate ga-68", "Gallium dotatate, ga-68", "Gallium dotatoc ga 68", "Gallium dotatoc ga-68", "Gallium edotreotide ga-68", "Gallium ga 68 dotatate", "Gallium ga 68 edotreotide", "Gallium ga 68-dotatoc", "Gallium ga 68-edotreotide", "Gallium ga-68 edotreotide", "Gallium oxodotreotide ga-68", "Gallium-dota-octreotate ga-68", "Gallium-dota-octreotate, ga-68", "Gatate", "Netspot", "Somakit toc" ], "moleculeClass": "peptide-conjugate", "status": "approved", "maxPhase": 4.0, "firstApproval": 2016, "sources": [ { "type": "chembl", "id": "CHEMBL262135", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL262135/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL4297340", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297340/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "gallium-oxodotreotide", "gpMatch": "name", "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "gallium-rofapitidexetan", "name": "Gallium Rofapitidexetan", "synonyms": [ "GALLIUM (68GA) ROFAPITIDE TETRAXETAN", "Galio (68ga) rofapitida tetraxetan", "Gallium (68ga) rofapitide tetraxetan" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5316152", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5316152/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL5314464", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314464/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide; -xetan", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "ganipatide", "name": "Ganipatide", "synonyms": [], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314835", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314835/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "ganirelix", "name": "Ganirelix", "synonyms": [ "Ganirelix acetate injection", "Ganirelix gedeon richter", "Ganirest", "Orgalutran", "RS-26306", "RS-26306-298" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1999, "sources": [ { "type": "chembl", "id": "CHEMBL1251", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1251/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL5314377", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314377/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "ganirelix", "gpMatch": "name", "innStem": "-relix", "usanYear": 1991, "chemblType": "Protein", "helm": "PEPTIDE1{[ac].[dNal].[dPhe(4-Cl)].[d3-Pal].S.Y.[X18].L.[X17].P.[dA].[am]}$$$$", "sequence": null }, { "id": "garetosmab", "name": "Garetosmab", "synonyms": [ "REGN2477" ], "moleculeClass": "antibody", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 37770652", "url": "https://pubmed.ncbi.nlm.nih.gov/37770652/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "garetosmab", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "gastrin", "name": "Gastrin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01350", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01350/entry", "note": "mature peptide 76-92 of Gastrin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "QGPWLEEEEEAYGWMDF" }, { "id": "gastrin-14", "name": "Gastrin-14", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01350", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01350/entry", "note": "mature peptide 79-92 of Gastrin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "WLEEEEEAYGWMDF" }, { "id": "gastrin-52", "name": "Gastrin-52", "synonyms": [], "moleculeClass": "protein", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01350", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01350/entry", "note": "mature peptide 41-92 of Gastrin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "DLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF" }, { "id": "gastrin-6", "name": "Gastrin-6", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01350", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01350/entry", "note": "mature peptide 87-92 of Gastrin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "YGWMDF" }, { "id": "gastrin-71", "name": "Gastrin-71", "synonyms": [], "moleculeClass": "protein", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01350", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01350/entry", "note": "mature peptide 22-92 of Gastrin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "SWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF" }, { "id": "gdf11", "name": "GDF11", "synonyms": [ "BMP-11", "Growth differentiation factor 11" ], "moleculeClass": "protein", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 23663781", "url": "https://pubmed.ncbi.nlm.nih.gov/23663781/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "gdf11", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "gdf15", "name": "GDF15", "synonyms": [ "Growth differentiation factor 15", "MIC-1", "NAG-1", "PLAB", "PTGFB" ], "moleculeClass": "protein", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 39282907", "url": "https://pubmed.ncbi.nlm.nih.gov/39282907/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "gdf15", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "gersizangitide", "name": "Gersizangitide", "synonyms": [ "AXT-107", "AXT107", "Gersizangitida", "Gersizangtide" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5095123", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5095123/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2023, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "ghk-cu", "name": "GHK-Cu", "synonyms": [ "glycyl-L-histidyl-L-lysine" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 73587", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/73587", "read": "2026-10-02", "note": "PubChem title: glycyl-L-histidyl-L-lysine" } ], "gpEntry": "ghk-cu", "gpMatch": "alias", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "ghrelin", "name": "Ghrelin", "synonyms": [ "Human ghrelin", "Lenomorelin", "Lenomorelina", "Lenomoreline" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108303", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108303/", "read": "2026-10-02" }, { "type": "uniprot", "id": "Q9UBU3", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9UBU3/entry", "note": "mature peptide 24-51 of Appetite-regulating hormone" }, { "type": "chembl", "id": "CHEMBL500468", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL500468/", "read": "2026-10-02", "note": "separate ChEMBL record of the same molecule" } ], "gpEntry": "ghrelin", "gpMatch": "alias", "innStem": "-relin", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{R.G.[X123].S.F.L.S.P.E.H.Q.K.A.Q.Q.R.K.E.S.K.K.P.P.A.K.L.Q.P}$$$$", "sequence": null }, { "id": "ghrelin-27", "name": "Ghrelin-27", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q9UBU3", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9UBU3/entry", "note": "mature peptide 24-50 of Appetite-regulating hormone" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "GSSFLSPEHQRVQQRKESKKPPAKLQP" }, { "id": "ghrp-1", "name": "GHRP-1", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 8049717", "url": "https://pubmed.ncbi.nlm.nih.gov/8049717/", "read": "2026-10-02", "note": "earliest PubMed record naming GHRP-1 in its title (1994): Effects in vitro of new growth hormone releasing peptide (GHRP-1) on growth hormone secretion from ovine pituitary cells" } ], "gpEntry": "ghrp-1", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "ghrp-2", "name": "GHRP-2", "synonyms": [ "Ghrp", "Ghrp-2", "KP-102", "Pralmorelina", "Pralmoreline", "WAY-GPA-748" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL106593", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL106593/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL2105772", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2105772/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "ghrp-2", "gpMatch": "consolidated", "innStem": "-relin", "usanYear": 1997, "chemblType": "Protein", "helm": "PEPTIDE1{[dA].[dNal].A.W.[dF].K.[am]}$$$$", "sequence": null }, { "id": "ghrp-6", "name": "GHRP-6", "synonyms": [ "Growth Hormone Releasing Peptide 6", "SKF-110679" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 7617137", "url": "https://pubmed.ncbi.nlm.nih.gov/7617137/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "ghrp-6", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "gi-heptapeptide", "name": "Gi Heptapeptide", "synonyms": [], "moleculeClass": "peptide", "status": "phase-1", "maxPhase": 1.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297759", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297759/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "gip", "name": "GIP", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P09681", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P09681/entry", "note": "mature peptide 52-93 of Gastric inhibitory polypeptide" } ], "gpEntry": "gip", "gpMatch": "alias", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ" }, { "id": "giractide", "name": "Giractide", "synonyms": [ "Giractida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2370090", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2370090/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{G.Y.S.M.E.H.F.R.W.G.K.P.V.G.K.K.R.R.[am]}$$$$", "sequence": null }, { "id": "glatiramer", "name": "Glatiramer Acetate", "synonyms": [ "Copaxone", "Copolymer 1", "Glatopa" ], "moleculeClass": "other", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 7617181", "url": "https://pubmed.ncbi.nlm.nih.gov/7617181/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "glatiramer", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "glepaglutide", "name": "Glepaglutide", "synonyms": [ "Glepaglutida", "ZP-1848", "ZP1848", "Zp1848" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297761", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297761/", "read": "2026-10-02" } ], "gpEntry": "glepaglutide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2017, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "glicentin", "name": "Glicentin", "synonyms": [], "moleculeClass": "protein", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01275", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01275/entry", "note": "mature peptide 21-89 of Pro-glucagon" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA" }, { "id": "glicentin-related-polypeptide", "name": "Glicentin-related polypeptide", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01275", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01275/entry", "note": "mature peptide 21-50 of Pro-glucagon" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "RSLQDTEEKSRSFSASQADPLSDPDQMNED" }, { "id": "glisentide", "name": "Glisentide", "synonyms": [ "Glisentida", "SU-661", "SU661", "Staticum", "UR-661", "UR661" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2105089", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2105089/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "gli-; -tide", "usanYear": null, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "glp-2", "name": "GLP-2", "synonyms": [ "1-33-glucagon-like peptide ii", "Glp-2", "Glp-2 (1-33)", "Glp-2 (human)", "Glucagon-like peptide 2" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297958", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297958/", "read": "2026-10-02" }, { "type": "uniprot", "id": "P01275", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01275/entry", "note": "mature peptide 146-178 of Pro-glucagon" } ], "gpEntry": "glp-2", "gpMatch": "alias", "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "glucagon", "name": "Glucagon", "synonyms": [ "Baqsimi", "Gvoke Hypopen", "Gvoke Kit", "Gvoke Pfs", "Gvoke Vialdx" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2015, "sources": [ { "type": "openfda", "id": "NDA201849", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=201849", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" }, { "type": "uniprot", "id": "P01275", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01275/entry", "note": "mature peptide 53-81 of Pro-glucagon" } ], "gpEntry": "glucagon", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "HSQGTFTSDYSKYLDSRRAQDFVQWLMNT" }, { "id": "glucagon-like-peptide-1", "name": "Glucagon-like Peptide 1", "synonyms": [ "Glp-1" ], "moleculeClass": "peptide", "status": "phase-1", "maxPhase": 1.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4594475", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4594475/", "read": "2026-10-02" }, { "type": "uniprot", "id": "P01275", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01275/entry", "note": "mature peptide 92-128 of Pro-glucagon" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "glucagon-like-peptide-1-7-37", "name": "Glucagon-like peptide 1(7-37)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01275", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01275/entry", "note": "mature peptide 98-128 of Pro-glucagon" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG" }, { "id": "glutathione", "name": "Glutathione", "synonyms": [ "GSH", "L-glutathione", "gamma-glutamylcysteinylglycine", "reduced glutathione", "γ-L-glutamyl-L-cysteinylglycine" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 37035339", "url": "https://pubmed.ncbi.nlm.nih.gov/37035339/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "glutathione", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "gnrh-associated-peptide-1", "name": "GnRH-associated peptide 1", "synonyms": [], "moleculeClass": "protein", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01148", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01148/entry", "note": "mature peptide 37-92 of Progonadoliberin-1" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "DAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI" }, { "id": "gnrh-associated-peptide-2", "name": "GnRH-associated peptide 2", "synonyms": [], "moleculeClass": "protein", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "O43555", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/O43555/entry", "note": "mature peptide 37-120 of Progonadoliberin-2" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "ALSSAQDPQNALRPPGRALDTAAGSPVQTAHGLPSDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV" }, { "id": "gonadoliberin-1", "name": "Gonadoliberin-1", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01148", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01148/entry", "note": "mature peptide 24-33 of Progonadoliberin-1" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "QHWSYGLRPG" }, { "id": "gonadoliberin-2", "name": "Gonadoliberin-2", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "O43555", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/O43555/entry", "note": "mature peptide 24-33 of Progonadoliberin-2" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "QHWSHGWYPG" }, { "id": "gonadorelin", "name": "Gonadorelin", "synonyms": [ "ABBOTT-41070", "AY-24,031", "AY-24031", "Factrel", "Fertagyl", "Fertiral lh-rh", "Gnrh", "Gonadorelin acetate anhydrous", "Gonadorelin acetate mixture", "Gonadorelin decapeptide", "Gonadorelin hcl", "Gonadorelina", "Gonadoreline", "Gonadotropin releasing hormone", "Gonadotropin-releasing hormone", "Hypocrine", "Lh releasing factor", "Luteinizing", "Luteinizing hormone-releasing factor diacetate tetrahydrate", "Luteinizing hormone-releasing factor dihydrochloride", "Lutrelef", "Lutrepulse kit", "Relefact lh-rh" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1982, "sources": [ { "type": "chembl", "id": "CHEMBL1007", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1007/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL1200511", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1200511/", "read": "2026-10-02", "note": "salt form, folded into this row" }, { "type": "chembl", "id": "CHEMBL1200516", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1200516/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "gonadorelin", "gpMatch": "name", "innStem": "-relin", "usanYear": 1975, "chemblType": "Protein", "helm": "PEPTIDE1{[Glp].H.W.S.Y.G.L.R.P.G.[am]}$$$$", "sequence": null }, { "id": "goralatide", "name": "Goralatide", "synonyms": [ "Ac-SDKP", "Ac-ser-asp-lys-pro", "Goralatida", "Seraspenide" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL420741", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL420741/", "read": "2026-10-02" }, { "type": "pubchem", "id": "CID 65938", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/65938", "read": "2026-10-02", "note": "PubChem title: Goralatide" } ], "gpEntry": "goralatide", "gpMatch": "name", "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{[ac].S.D.K.P}$$$$", "sequence": null }, { "id": "goserelin", "name": "Goserelin", "synonyms": [ "Fertilan", "Goserelina", "Gosereline", "ICI 118,630", "ICI-118630", "Novgos", "Zoladex", "Zoladex la" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1989, "sources": [ { "type": "chembl", "id": "CHEMBL1201247", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1201247/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL1200501", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1200501/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "goserelin", "gpMatch": "name", "innStem": "-relin", "usanYear": 1987, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "gozetotide", "name": "Gozetotide", "synonyms": [ "(68ga)hbed-psma", "(68ga)psma-hbed-cc", "(al18f)psma-hbed", "18f-psma", "18f-psma-11", "68Ga-PSMA-11", "68ga-psma-11", "68ga-psma-hbed-cc", "Al(18f)psma-11", "DKFZ-PSMA-11 GA-68", "GALLIUM GA 68 GOZETOTIDE", "GOZETOTIDE ALF-18", "Ga-68 psma-11", "Ga-68-labeled psma-11", "Ga-psma-hbed-cc ga-68", "Gallium (68ga) gozetotide", "Gallium ga 68 gozetotide", "Gallium ga 68 psma-11", "Gallium ga 68-labeled psma ligand glu-urea-lys(ahx)-hbed-cc", "Gallium ga-68 gozetotide", "Gallium ga-68 psma-11", "Gallium gozetotide ga-68", "Glu-urea-lys(ahx)-hbed-cc ga-68", "Gozetotide alf-18", "Illuccix", "Locametz", "Prostamedix", "Psma-11", "Psma-11 ga 68", "Psma-11 ga-68", "Psma-hbed-cc", "Psma-hbed-cc alf-18", "Psma-hbed-cc ga-68" ], "moleculeClass": "peptidomimetic", "status": "approved", "maxPhase": 4.0, "firstApproval": 2020, "sources": [ { "type": "chembl", "id": "CHEMBL3578202", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3578202/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL4650355", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4650355/", "read": "2026-10-02", "note": "salt form, folded into this row" }, { "type": "chembl", "id": "CHEMBL5095039", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5095039/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "gozetotide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2021, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "gramicidin", "name": "Gramicidin", "synonyms": [ "Neomycin And Polymyxin B Sulfates And Gramicidin" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1996, "sources": [ { "type": "openfda", "id": "ANDA064047", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=064047", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "gramicidin", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "guanylate-cyclase-c-activating-peptide-2", "name": "Guanylate cyclase C-activating peptide 2", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q16661", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q16661/entry", "note": "mature peptide 89-112 of Guanylate cyclase activator 2B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "FKTLRTIANDDCELCVNVACTGCL" }, { "id": "guanylin", "name": "Guanylin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q02747", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q02747/entry", "note": "mature peptide 101-115 of Guanylin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "PGTCEICAYAACTGC" }, { "id": "hbd-1", "name": "hBD-1", "synonyms": [ "DEFB1", "defensin β1", "human β-defensin 1" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 7628632", "url": "https://pubmed.ncbi.nlm.nih.gov/7628632/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "hbd-1", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "hbd-2", "name": "hBD-2", "synonyms": [ "DEFB4", "DEFB4A", "SAP1 — skin-antimicrobial peptide 1", "defensin β2", "human β-defensin 2" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 9202117", "url": "https://pubmed.ncbi.nlm.nih.gov/9202117/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "hbd-2", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "hbd-3", "name": "hBD-3", "synonyms": [ "DEFB103", "DEFB103A", "defensin β3", "human β-defensin 3" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 11085990", "url": "https://pubmed.ncbi.nlm.nih.gov/11085990/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "hbd-3", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "hcg", "name": "HCG", "synonyms": [ "Novarel", "Ovidrel", "Pregnyl", "choriogonadotropin alfa", "human chorionic gonadotropin" ], "moleculeClass": "protein", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 15713727", "url": "https://pubmed.ncbi.nlm.nih.gov/15713727/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "hcg", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "hd5", "name": "HD5", "synonyms": [ "DEFA5", "defensin α5", "enteric α-defensin 5", "human α-defensin 5" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 27636409", "url": "https://pubmed.ncbi.nlm.nih.gov/27636409/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "hd5", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "hd6", "name": "HD6", "synonyms": [ "DEFA6", "defensin α6", "enteric α-defensin 6", "human α-defensin 6" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 22722251", "url": "https://pubmed.ncbi.nlm.nih.gov/22722251/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "hd6", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "hepalatide", "name": "Hepalatide", "synonyms": [ "L47" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4650398", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4650398/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "hepcidin-20", "name": "Hepcidin-20", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P81172", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P81172/entry", "note": "mature peptide 65-84 of Hepcidin, 2 copies" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "ICIFCCGCCHRSKCGMCCKT" }, { "id": "hepcidin-25", "name": "Hepcidin-25", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P81172", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P81172/entry", "note": "mature peptide 60-84 of Hepcidin, 2 copies" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "DTHFPICIFCCGCCHRSKCGMCCKT" }, { "id": "hexapeptide-11", "name": "Hexapeptide-11", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 24998056", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/24998056", "read": "2026-10-02", "note": "PubChem title: Hexapeptide-11" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "hexapeptide-9", "name": "Hexapeptide-9", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 16129319", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/16129319", "read": "2026-10-02", "note": "PubChem title: Hexapeptide-9" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "hexarelin", "name": "Hexarelin", "synonyms": [ "EP-23905", "Examorelina", "Examoreline", "Hexarelin", "MF-6003" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL108335", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL108335/", "read": "2026-10-02" } ], "gpEntry": "hexarelin", "gpMatch": "consolidated", "innStem": "-relin", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{H.[X155].A.W.[dF].K.[am]}$$$$", "sequence": null }, { "id": "histatin", "name": "Histatin", "synonyms": [ "Histatin-1", "Histatin-3", "Histatin-5", "Salivary histatins" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 12492903", "url": "https://pubmed.ncbi.nlm.nih.gov/12492903/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "histatin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "histrelin", "name": "Histrelin", "synonyms": [ "Histrelina", "Histreline", "ORF 17070", "ORF 17070RWJ 17070", "ORF-17070", "RWJ 17070", "RWJ-17070", "Supprelin", "Supprelin la", "Vantas" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1991, "sources": [ { "type": "chembl", "id": "CHEMBL1201255", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1201255/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL1200509", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1200509/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "histrelin", "gpMatch": "name", "innStem": "-relin", "usanYear": 1985, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "hm15136", "name": "HM15136", "synonyms": [ "Efpegerglucagon" ], "moleculeClass": "peptide-conjugate", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 34726329", "url": "https://pubmed.ncbi.nlm.nih.gov/34726329/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "hm15136", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "hm15275", "name": "HM15275", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "clinicaltrials", "id": "NCT06481098", "url": "https://clinicaltrials.gov/study/NCT06481098", "read": "2026-10-02", "note": "trial registration cited on the encyclopedia entry" } ], "gpEntry": "hm15275", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "hnp-1", "name": "HNP-1", "synonyms": [ "DEFA1", "defensin α1", "human neutrophil peptide 1", "human α-defensin 1", "myeloid-related sequence peptide 30a" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 2997278", "url": "https://pubmed.ncbi.nlm.nih.gov/2997278/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "hnp-1", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "hrs9531", "name": "HRS-9531", "synonyms": [ "KAI-9531", "ribupatide" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 42764407", "url": "https://pubmed.ncbi.nlm.nih.gov/42764407/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "hrs9531", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "human-c-peptide", "name": "Human C-peptide", "synonyms": [ "C-peptide", "Human proinsulin c-peptide", "Insulin c-peptide", "Nmij-crm 6901a", "Proinsulin c-peptide", "Proinsulin c-peptide (human)" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4594409", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4594409/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "human-neuropeptide-y", "name": "Human Neuropeptide Y", "synonyms": [], "moleculeClass": "peptide", "status": "phase-1", "maxPhase": 1.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL438945", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL438945/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{Y.P.S.K.P.D.N.P.G.E.D.A.P.A.E.D.M.A.R.Y.Y.S.A.L.R.H.Y.I.N.L.I.T.R.Q.R.Y.[am]}$$$$", "sequence": null }, { "id": "humanin", "name": "Humanin", "synonyms": [ "HN", "MTRNR2", "S14G-Humanin (HNG)" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 15655255", "url": "https://pubmed.ncbi.nlm.nih.gov/15655255/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "humanin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "hyaluronic-acid", "name": "Hyaluronic Acid", "synonyms": [ "Euflexxa", "HA", "Hyaluronan", "Juvéderm", "Restylane", "Sodium hyaluronate", "Synvisc" ], "moleculeClass": "other", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 17309996", "url": "https://pubmed.ncbi.nlm.nih.gov/17309996/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "hyaluronic-acid", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "icatibant", "name": "Icatibant", "synonyms": [ "Firazyr", "HOE 140" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 20818888", "url": "https://pubmed.ncbi.nlm.nih.gov/20818888/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "icatibant", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "icotrokinra", "name": "Icotrokinra", "synonyms": [ "Icotyde" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2026, "sources": [ { "type": "openfda", "id": "NDA220149", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=220149", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "icotrokinra", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "icrocaptide", "name": "Icrocaptide", "synonyms": [ "ITF-1697", "ITF1697", "Icrocaptida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2107753", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2107753/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{G.[X925].[X924]}$$$$", "sequence": null }, { "id": "ideglira", "name": "Insulin degludec / liraglutide (IDegLira)", "synonyms": [ "IDegLira", "Xultophy", "Xultophy 100/3.6" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 25190523", "url": "https://pubmed.ncbi.nlm.nih.gov/25190523/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "ideglira", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "igf-1", "name": "IGF-1", "synonyms": [ "IGF-I", "Insulin-like Growth Factor 1", "Somatomedin C" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 17192294", "url": "https://pubmed.ncbi.nlm.nih.gov/17192294/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "igf-1", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "igf-1-des", "name": "IGF-1 DES(1-3)", "synonyms": [ "DES IGF-1", "DES(1-3) IGF-1", "des1-3 IGF-1" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 8930132", "url": "https://pubmed.ncbi.nlm.nih.gov/8930132/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "igf-1-des", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "igf-1-lr3", "name": "IGF-1 LR3", "synonyms": [ "LR3 IGF-1", "Long Arg3 IGF-1", "Long R3 IGF-1" ], "moleculeClass": "protein", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 7561636", "url": "https://pubmed.ncbi.nlm.nih.gov/7561636/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "igf-1-lr3", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "iglarlixi", "name": "Insulin glargine / lixisenatide (iGlarLixi)", "synonyms": [ "Soliqua", "Soliqua 100/33", "Suliqua", "iGlarLixi" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 27284114", "url": "https://pubmed.ncbi.nlm.nih.gov/27284114/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "iglarlixi", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "ilatreotide", "name": "Ilatreotide", "synonyms": [ "Ilatreotida", "SDZ CO 611", "SDZ-CO-611" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2104390", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2104390/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Oligosaccharide", "helm": null, "sequence": null }, { "id": "imsamotide", "name": "Imsamotide", "synonyms": [ "Imsamotida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314745", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314745/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "indium-in-111-capromab-pendetide", "name": "Indium In 111 Capromab Pendetide", "synonyms": [ "(sup 111)in-capromab pendetide", "CYT-351", "Capromab pendetide", "Indium (111in) capromab pendetide", "Indium in-111 prostascint", "Prostascint indium in-111" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108800", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108800/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-mab; -tide", "usanYear": null, "chemblType": "Antibody", "helm": null, "sequence": null }, { "id": "indium-in-111-satumomab-pendetide", "name": "Indium In 111 Satumomab Pendetide", "synonyms": [ "B72.3", "CYT-099", "CYT-103", "CYT-103 (111IN)", "CYT-103 111 IN", "IN-111 CYT-103", "Indium (111in) satumomab pendetide", "Indium in 111 cyt-103", "Monab b72.3-gyk-dtpa-111in", "Oncoscint", "Satumomab", "Satumomab pendetide", "Satumomab pendetide 111in", "Satumomab pendetide indium in-111" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1991, "sources": [ { "type": "chembl", "id": "CHEMBL1743091", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1743091/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-mab; -tide", "usanYear": 1993, "chemblType": "Antibody", "helm": null, "sequence": null }, { "id": "indium-pentetreotide", "name": "Indium In 111 pentetreotide", "synonyms": [ "(sup 111)indium pentetreotide", "111indium pentetreotide", "INDIUM IN 111 PENTETREOTIDE", "Indium (111 in) pentetreotide", "Indium (111in) pentetreotide", "Indium in 111 pentetreotide", "Indium in-111 pentetreotide", "Indium in-111 pentetreotide kit", "Indium-111 pentetreotide", "MP-1727", "Octreoscan", "Pentetreotide 111in chelate" ], "moleculeClass": "peptide-conjugate", "status": "approved", "maxPhase": 4.0, "firstApproval": 1994, "sources": [ { "type": "chembl", "id": "CHEMBL2110556", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2110556/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL1200642", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1200642/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "indium-pentetreotide", "gpMatch": "name", "innStem": "-tide", "usanYear": 1995, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "insulin-a-chain", "name": "Insulin A chain", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01308", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01308/entry", "note": "mature peptide 90-110 of Insulin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "GIVEQCCTSICSLYQLENYCN" }, { "id": "insulin-aspart", "name": "Insulin aspart", "synonyms": [ "Fiasp", "Kirsty", "NovoLog", "NovoRapid" ], "moleculeClass": "protein", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 10353301", "url": "https://pubmed.ncbi.nlm.nih.gov/10353301/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "insulin-aspart", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "insulin-b-chain", "name": "Insulin B chain", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01308", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01308/entry", "note": "mature peptide 25-54 of Insulin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "FVNQHLCGSHLVEALYLVCGERGFFYTPKT" }, { "id": "insulin-degludec", "name": "Insulin degludec", "synonyms": [ "NN1250", "Tresiba", "Xultophy (combo)" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 28605603", "url": "https://pubmed.ncbi.nlm.nih.gov/28605603/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "insulin-degludec", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "insulin-detemir", "name": "Insulin detemir", "synonyms": [ "Levemir", "NN304" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 19565569", "url": "https://pubmed.ncbi.nlm.nih.gov/19565569/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "insulin-detemir", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "insulin-efsitora", "name": "Insulin efsitora alfa", "synonyms": [ "LY3209590", "basal insulin Fc", "efsitora", "efsitora alfa" ], "moleculeClass": "protein", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 40548694", "url": "https://pubmed.ncbi.nlm.nih.gov/40548694/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "insulin-efsitora", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "insulin-glargine", "name": "Insulin glargine", "synonyms": [ "Basaglar", "Lantus", "Rezvoglar", "Semglee", "Toujeo" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 11315821", "url": "https://pubmed.ncbi.nlm.nih.gov/11315821/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "insulin-glargine", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "insulin-glulisine", "name": "Insulin glulisine", "synonyms": [ "Apidra", "HMR1964" ], "moleculeClass": "protein", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 21291333", "url": "https://pubmed.ncbi.nlm.nih.gov/21291333/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "insulin-glulisine", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "insulin-icodec", "name": "Insulin icodec", "synonyms": [ "Awiqli", "NN1436" ], "moleculeClass": "protein", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 37356066", "url": "https://pubmed.ncbi.nlm.nih.gov/37356066/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "insulin-icodec", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "insulin-like-3-a-chain", "name": "Insulin-like 3 A chain", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P51460", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P51460/entry", "note": "mature peptide 106-131 of Insulin-like 3" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "AAATNPARYCCLSGCTQQDLLTLCPY" }, { "id": "insulin-like-3-b-chain", "name": "Insulin-like 3 B chain", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P51460", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P51460/entry", "note": "mature peptide 21-55 of Insulin-like 3" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "LGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEA" }, { "id": "insulin-like-peptide-insl5-a-chain", "name": "Insulin-like peptide INSL5 A chain", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q9Y5Q6", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9Y5Q6/entry", "note": "mature peptide 115-135 of Insulin-like peptide INSL5" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "QDLQTLCCTDGCSMTDLSALC" }, { "id": "insulin-like-peptide-insl5-b-chain", "name": "Insulin-like peptide INSL5 B chain", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q9Y5Q6", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9Y5Q6/entry", "note": "mature peptide 23-46 of Insulin-like peptide INSL5" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "KESVRLCGLEYIRTVIYICASSRW" }, { "id": "insulin-like-peptide-insl6-a-chain", "name": "Insulin-like peptide INSL6 A chain", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q9Y581", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9Y581/entry", "note": "mature peptide 173-198 of Insulin-like peptide INSL6" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "GYSEKCCLTGCTKEELSIACLPYIDF" }, { "id": "insulin-like-peptide-insl6-b-chain", "name": "Insulin-like peptide INSL6 B chain", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q9Y581", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9Y581/entry", "note": "mature peptide 21-53 of Insulin-like peptide INSL6" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "RELSDISSARKLCGRYLVKEIEKLCGHANWSQF" }, { "id": "insulin-lispro", "name": "Insulin lispro", "synonyms": [ "Admelog", "Humalog", "LY275585", "Lyumjev" ], "moleculeClass": "protein", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 37786396", "url": "https://pubmed.ncbi.nlm.nih.gov/37786396/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "insulin-lispro", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "insulin-nph", "name": "NPH insulin (isophane)", "synonyms": [ "Humulin N", "NPH", "Novolin N", "isophane insulin" ], "moleculeClass": "protein", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 1516500", "url": "https://pubmed.ncbi.nlm.nih.gov/1516500/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "insulin-nph", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "insulin-regular", "name": "Regular human insulin", "synonyms": [ "Humulin R", "Humulin R U-500", "Myxredlin", "Novolin R" ], "moleculeClass": "protein", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 25813411", "url": "https://pubmed.ncbi.nlm.nih.gov/25813411/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "insulin-regular", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "intermedin-short", "name": "Intermedin-short", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q7Z4H4", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q7Z4H4/entry", "note": "mature peptide 108-147 of Protein ADM2" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "VGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY" }, { "id": "intestinal-peptide-phm-27", "name": "Intestinal peptide PHM-27", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01282", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01282/entry", "note": "mature peptide 81-107 of VIP peptides" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "HADGVFTSDFSKLLGQLSAKKYLESLM" }, { "id": "intestinal-peptide-phv-42", "name": "Intestinal peptide PHV-42", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01282", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01282/entry", "note": "mature peptide 81-122 of VIP peptides" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "HADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPV" }, { "id": "invopressin", "name": "Invopressin", "synonyms": [ "Invopressina", "Invopressine", "Oce-205" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314925", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314925/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-pressin", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "iodine-i124-evuzamitide", "name": "Iodine i124 Evuzamitide", "synonyms": [ "124I-p5+14", "124i-at-01", "APi1832", "AT-01", "Evuzamitide iodine i-124", "Iodine (124i) evuzamitide" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314633", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314633/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "io-; -tide", "usanYear": 2023, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "ipamorelin", "name": "Ipamorelin", "synonyms": [ "Aib-his-d-2-nal-d-phe-lys-nh2", "Ipamorelina", "Ipamoreline", "NNC 26-0161", "NNC-26-0161", "NNC-260161" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL58547", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL58547/", "read": "2026-10-02" } ], "gpEntry": "ipamorelin", "gpMatch": "name", "innStem": "-relin", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{[Aib].H.[dNal].[dF].K.[am]}$$$$", "sequence": null }, { "id": "irucalantide", "name": "Irucalantide", "synonyms": [ "Irucalantida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314840", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314840/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "iturelix", "name": "Iturelix", "synonyms": [ "Antide", "Nal-lys anatagonist", "ORF-32541" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3989438", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3989438/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-relix", "usanYear": 2000, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "kaliuretic-peptide", "name": "Kaliuretic peptide", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01160", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01160/entry", "note": "mature peptide 104-123 of Natriuretic peptides A" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "SSDRSALLKSKLRALLTAPR" }, { "id": "katacalcin", "name": "Katacalcin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01258", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01258/entry", "note": "mature peptide 121-141 of Calcitonin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "DMSSDLERDHRPHVSMPQNAN" }, { "id": "kep", "name": "KEP", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q9UHG2", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9UHG2/entry", "note": "mature peptide 34-40 of ProSAAS" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "ARPVKEP" }, { "id": "kisspeptin-10", "name": "Kisspeptin-10", "synonyms": [ "KISS1(68-77)", "Kp-10", "metastin 45-54" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 21632807", "url": "https://pubmed.ncbi.nlm.nih.gov/21632807/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "kisspeptin-10", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "kisspeptin-54", "name": "Kisspeptin-54", "synonyms": [ "KISS1(68-121)", "Kp-54", "metastin" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 26192876", "url": "https://pubmed.ncbi.nlm.nih.gov/26192876/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "kisspeptin-54", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "klotho-peptide", "name": "Klotho Peptide", "synonyms": [ "KL-VS", "S-Klotho", "Soluble Klotho", "α-Klotho" ], "moleculeClass": "protein", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 35053218", "url": "https://pubmed.ncbi.nlm.nih.gov/35053218/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "klotho-peptide", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "kn056", "name": "KN056", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 40328758", "url": "https://pubmed.ncbi.nlm.nih.gov/40328758/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "kn056", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "kpv", "name": "KPV", "synonyms": [ "Lys-Pro-Val", "lysine-proline-valine", "tripeptide KPV", "α-MSH(11-13)" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 6333677", "url": "https://pubmed.ncbi.nlm.nih.gov/6333677/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "kpv", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "kr-12", "name": "KR-12", "synonyms": [ "KRIVQRIKDFLR", "LL-37(18-29)", "minimal LL-37 antimicrobial fragment" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 18818205", "url": "https://pubmed.ncbi.nlm.nih.gov/18818205/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "kr-12", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "l-carnitine", "name": "L-carnitine", "synonyms": [ "(-)-Carnitine" ], "moleculeClass": "small-molecule", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 10917", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/10917", "read": "2026-10-02", "note": "PubChem title: (-)-Carnitine" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "lactoferricin", "name": "Lactoferricin", "synonyms": [ "Lactoferricin B", "Lactoferricin H", "LfcinB" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 16261252", "url": "https://pubmed.ncbi.nlm.nih.gov/16261252/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "lactoferricin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "lagatide", "name": "Lagatide", "synonyms": [ "BN-52080", "BN52080", "Lagatida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2218863", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2218863/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{P.V.T.K.P.Q.[dA].[am]}$$$$", "sequence": null }, { "id": "lancovutide", "name": "Lancovutide", "synonyms": [ "Duramycin", "Lancovutida", "Leucopeptin", "MOLI-1901", "MOLI1901", "Moli1901" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108327", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108327/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "lanreotide", "name": "Lanreotide", "synonyms": [ "Angiopeptin", "BIM-23014C", "Lanreotida", "Somatuline", "Somatuline autogel", "Somatuline depot", "Somatuline la", "Somatuline lp" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2007, "sources": [ { "type": "chembl", "id": "CHEMBL1201185", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1201185/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL1201184", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1201184/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "lanreotide", "gpMatch": "name", "innStem": "-tide", "usanYear": 1992, "chemblType": "Protein", "helm": "PEPTIDE1{[dNal].C.Y.[dW].K.V.C.T.[am]}$PEPTIDE1,PEPTIDE1,7:R3-2:R3$$$", "sequence": null }, { "id": "larazotide", "name": "Larazotide", "synonyms": [ "AT-1001", "AT-1001 (LARAZOTIDE ACETATE)", "AT-2347", "Larazotida" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2105646", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2105646/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL2103815", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2103815/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "larazotide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2007, "chemblType": "Protein", "helm": "PEPTIDE1{G.G.V.L.V.Q.P.G}$$$$", "sequence": null }, { "id": "lead-bamzireotide-navoxetan", "name": "Lead Bamzireotide Navoxetan", "synonyms": [ "LEAD (212PB) BAMZIREOTIDE NAVOXETAN", "Lead (212pb) bamzireotide navoxetan", "Plomb (212pb) bamzireotide navoxetan", "Plomo (212pb) bamzireotida navoxetan" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068769", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068769/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL6068067", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068067/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide; -xetan", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "lead-lapemelanotide-zapixetan", "name": "Lead Lapemelanotide Zapixetan", "synonyms": [ "LEAD (212PB) LAPEMELANOTIDE ZAPIXETAN", "Lead (212pb) lapemelanotide zapixetan", "Plomb (212pb) lapemelanotide zapixetan", "Plomo (212pb) lapemelanotide zapixetan" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068770", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068770/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL6068068", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068068/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide; -xetan", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "leconotide", "name": "Leconotide", "synonyms": [ "Leconotida", "Omega-conopeptide mviia" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108419", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108419/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "leumorphin", "name": "Leumorphin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01213", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01213/entry", "note": "mature peptide 226-254 of Proenkephalin-B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "YGGFLRRQFKVVTRSQEDPNAYSGELFDA" }, { "id": "leuphasyl", "name": "Leuphasyl", "synonyms": [ "Pentapeptide-18", "Tyr-D-Ala-Gly-Phe-Leu" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 41722287", "url": "https://pubmed.ncbi.nlm.nih.gov/41722287/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "leuphasyl", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "leuprolide", "name": "Leuprolide", "synonyms": [ "Camcevi", "Eligard", "Fensolvi", "Lupron", "Lupron Depot", "leuprorelin" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 2108883", "url": "https://pubmed.ncbi.nlm.nih.gov/2108883/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "leuprolide", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "linaclotide", "name": "Linaclotide", "synonyms": [ "ASP-0456", "ASP0456", "Constella", "Linaclotida", "Linzess", "MD-1100", "MD-1100 ACETATE", "MD-7246 (DELAYED RELEASE FORMULATION)", "MM-416775" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2012, "sources": [ { "type": "chembl", "id": "CHEMBL3301675", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3301675/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL3301676", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3301676/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "linaclotide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2005, "chemblType": "Protein", "helm": "PEPTIDE1{C.C.E.Y.C.C.N.P.A.C.T.G.C.Y}$PEPTIDE1,PEPTIDE1,10:R3-2:R3|PEPTIDE1,PEPTIDE1,6:R3-1:R3|PEPTIDE1,PEPTIDE1,13:R3-5:R3$$$", "sequence": null }, { "id": "lipotropin-beta", "name": "Lipotropin beta", "synonyms": [], "moleculeClass": "protein", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01189", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01189/entry", "note": "mature peptide 179-267 of Pro-opiomelanocortin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "ELTGQRLREGDGPDGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE" }, { "id": "lipotropin-gamma", "name": "Lipotropin gamma", "synonyms": [], "moleculeClass": "protein", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01189", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01189/entry", "note": "mature peptide 179-234 of Pro-opiomelanocortin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "ELTGQRLREGDGPDGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKD" }, { "id": "liraglutide", "name": "Liraglutide", "synonyms": [ "Liraglutida", "Liraglutide (rdna origin)", "Liraglutide component of xultophy 100/3.6", "Liraglutide recombinant", "NN-2211", "NN-9924", "NN2211", "NN9924", "NNC 90-1170", "NNC-90-1170", "Saxenda", "Victoza" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2009, "sources": [ { "type": "chembl", "id": "CHEMBL4084119", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4084119/", "read": "2026-10-02" } ], "gpEntry": "liraglutide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2007, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "little-len", "name": "Little LEN", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q9UHG2", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9UHG2/entry", "note": "mature peptide 245-254 of ProSAAS" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "LETPAPQVPA" }, { "id": "little-saas", "name": "Little SAAS", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q9UHG2", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9UHG2/entry", "note": "mature peptide 42-59 of ProSAAS" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "GLSAASPPLAETGAPRRF" }, { "id": "livagen", "name": "Livagen", "synonyms": [ "KEDA", "Lys-Glu-Asp-Ala" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 32362099", "url": "https://pubmed.ncbi.nlm.nih.gov/32362099/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "livagen", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "livoletide", "name": "Livoletide", "synonyms": [ "AZP 531", "AZP-531", "AZP531", "Azp-531", "Livoletida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2029605", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2029605/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{E.H.Q.R.V.Q.S.P}$PEPTIDE1,PEPTIDE1,8:R2-1:R1$$$", "sequence": null }, { "id": "lixisenatide", "name": "Lixisenatide", "synonyms": [ "AVE 010", "AVE-0010", "AVE-010", "AVE0010", "Lixisenatida", "Lixisenatide component of soliqua 100/33", "Lyxumia", "ZP 10", "ZP-10" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2013, "sources": [ { "type": "chembl", "id": "CHEMBL2108336", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108336/", "read": "2026-10-02" } ], "gpEntry": "lixisenatide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2013, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "lixivaptan", "name": "Lixivaptan", "synonyms": [ "Jinarc Alternative", "VPA-985" ], "moleculeClass": "small-molecule", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 22932119", "url": "https://pubmed.ncbi.nlm.nih.gov/22932119/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "lixivaptan", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "ll-37", "name": "LL-37", "synonyms": [ "CAMP", "Cathelicidin LL-37", "human cationic antimicrobial protein 18 (hCAP18)" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 25041740", "url": "https://pubmed.ncbi.nlm.nih.gov/25041740/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "ll-37", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "lonapegsomatropin", "name": "Lonapegsomatropin", "synonyms": [ "ACP-011", "Skytrofa", "TransCon growth hormone", "TransCon hGH", "lonapegsomatropin-tcgd" ], "moleculeClass": "protein", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 34272849", "url": "https://pubmed.ncbi.nlm.nih.gov/34272849/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "lonapegsomatropin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "long-acting-natriuretic-peptide", "name": "Long-acting natriuretic peptide", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01160", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01160/entry", "note": "mature peptide 26-55 of Natriuretic peptides A" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "NPMYNAVSNADLMDFKNLLDHLEEKMPLED" }, { "id": "lorutengitide", "name": "Lorutengitide", "synonyms": [ "Lorutengitida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068133", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068133/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "lsalt-peptide", "name": "Lsalt Peptide", "synonyms": [ "Metablok" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314991", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314991/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-sal-; -tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "lucicebtide", "name": "Lucicebtide", "synonyms": [ "Lucicebtida", "ST-101 (D-AMINO ACID PEPTIDE)", "ST101 (peptide)" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314846", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314846/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2024, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "lunasin", "name": "Lunasin", "synonyms": [ "Lunasine" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 20054959", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/20054959", "read": "2026-10-02", "note": "PubChem title: Lunasine" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "lusupultide", "name": "Lusupultide", "synonyms": [ "B-9420-001", "B9420-001", "Lusupultida", "Rsp-c surfactant" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2218909", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2218909/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2007, "chemblType": "Protein", "helm": "PEPTIDE1{G.I.P.F.F.P.V.H.L.K.R.L.L.I.V.V.V.V.V.V.L.I.V.V.V.I.V.G.A.L.L.I.G.L}$$$$", "sequence": null }, { "id": "lutetium-177-dotatate", "name": "Lutetium-177 DOTATATE", "synonyms": [ "(177)lu-dotatate", "177lu-dota-tyr3-octreotate", "177lu-dotatate", "Dota-octreotate lutetium lu-177", "Dotatate lutenium lu-177", "Dotatate lutetium lu-177", "LUTETIUM OXODOTREOTIDE LU-177", "Lutathera", "Lutecio (177lu) oxodotreotida", "Lutecium (177lu) oxodotreotide", "Lutetium (177lu) dotatate", "Lutetium (177lu) oxodotreotide", "Lutetium dotatate lu-177", "Lutetium dotatate, lu-177", "Lutetium lu 177 dotatate", "Lutetium lu-177 dotatate", "Lutetium oxodotreotide lu-177", "Oxodotreotide lutetium lu-177", "Oxodotreotide lutetium, lu-177" ], "moleculeClass": "peptide-conjugate", "status": "approved", "maxPhase": 4.0, "firstApproval": 2017, "sources": [ { "type": "chembl", "id": "CHEMBL4302409", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4302409/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL4297545", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297545/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "lutetium-177-dotatate", "gpMatch": "alias", "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "lutetium-lu-177-zadavotide-guraxetan", "name": "Lutetium Lu 177 Zadavotide Guraxetan", "synonyms": [ "177lu-pnt2002", "Pnt2002 lu-177", "Zadavotide guraxetan lutetium lu-177" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314936", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314936/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide; -xetan", "usanYear": 2024, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "lutetium-lu177-edotreotide", "name": "Lutetium Lu177 Edotreotide", "synonyms": [ "(177ludota)-toc", "177lu-dotatoc", "Dotatoc lu-177", "Edotreotide lutetium lu-177", "Lutecio lu177 edotreotida", "Lutecium lu177 edotreotide", "Lutetium (177lu) edotreotide" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5095425", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5095425/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2022, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "lutetium-rofapitidexetan", "name": "Lutetium Rofapitidexetan", "synonyms": [ "LUTETIUM (LU177) ROFAPITIDE TETRAXETAN", "Lutecio (lu177) rofapitida tetraxetan", "Lutecium (lu177) rofapitide tetraxetan", "Lutetium (lu177) rofapitide tetraxetan" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5316153", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5316153/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL5314468", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314468/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide; -xetan", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "lutetium-tezuvotidexetan", "name": "Lutetium Tezuvotidexetan", "synonyms": [ "177lu-rhpsma-10.1", "LUTETIUM (177LU) TEZUVOTIDE TETRAXETAN", "Luteci0 (177lu) tezuvotida tetraxetan", "Lutecium (177lu) tezuvotide tetraxetan", "Lutetium (177lu) rhpsma-10.1", "Lutetium (177lu) tezuvotide tetraxetan", "Rhpsma-10.1 lutetium lu-177" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068768", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068768/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL6068058", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068058/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide; -xetan", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "lutrelin", "name": "Lutrelin", "synonyms": [ "Lutrelina", "Lutreline", "WY-40,972", "WY-40972", "WY40,972" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2370578", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2370578/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL3989436", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3989436/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": null, "gpMatch": null, "innStem": "-relin", "usanYear": 1984, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "lutropin-alfa", "name": "Lutropin alfa", "synonyms": [ "Luveris", "rLH" ], "moleculeClass": "protein", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 28137754", "url": "https://pubmed.ncbi.nlm.nih.gov/28137754/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "lutropin-alfa", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "lypressin", "name": "Lypressin", "synonyms": [ "8-l-lysinevasopressin", "Diapid", "L-8", "Lipresina", "Lypressine", "Lysine vasopressin", "Vasopressin pig", "Vasopressin, 8-l-lysine" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1982, "sources": [ { "type": "chembl", "id": "CHEMBL1200690", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1200690/", "read": "2026-10-02" } ], "gpEntry": "lypressin", "gpMatch": "name", "innStem": "-pressin", "usanYear": 1965, "chemblType": "Protein", "helm": "PEPTIDE1{C.Y.F.Q.N.C.P.K.G.[am]}$PEPTIDE1,PEPTIDE1,6:R3-1:R3$$$", "sequence": null }, { "id": "macimorelin", "name": "Macimorelin", "synonyms": [ "AEZS-130", "ARD 07", "ARD-07", "ARD-07 ACETATE", "ARD07", "Ard-07", "D-87575", "D-87575 ACETATE", "EP 1572", "EP-01572", "EP-1572", "EP-1572 ACETATE", "EP01572", "EP1572", "Ghryvelin (previously macimorelin aeterna zentaris)", "JMV 1843", "JMV-1843", "Macimorelina", "Macimoreline", "Macrilen", "Solorel" ], "moleculeClass": "small-molecule", "status": "approved", "maxPhase": 4.0, "firstApproval": 2017, "sources": [ { "type": "chembl", "id": "CHEMBL278623", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL278623/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL2364617", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2364617/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "macimorelin", "gpMatch": "name", "innStem": "-relin", "usanYear": 2013, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "macupatide", "name": "Macupatide", "synonyms": [ "LY3532226" ], "moleculeClass": "peptide", "status": "phase-1", "maxPhase": 1.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068487", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068487/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2024, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "magainin", "name": "Magainin", "synonyms": [ "MSI-78", "Magainin 2", "Pexiganan" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 18990064", "url": "https://pubmed.ncbi.nlm.nih.gov/18990064/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "magainin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "maraciclatide", "name": "Maraciclatide", "synonyms": [ "Maraciclatida", "NC 100692", "NC-100692", "NC100692" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3989765", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3989765/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2009, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "maridebart-cafraglutide", "name": "Maridebart cafraglutide", "synonyms": [ "Maridebart cafraglutida" ], "moleculeClass": "peptide-conjugate", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314751", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314751/", "read": "2026-10-02" } ], "gpEntry": "maridebart-cafraglutide", "gpMatch": "name", "innStem": "-bart; -tide", "usanYear": null, "chemblType": "Antibody drug conjugate", "helm": null, "sequence": null }, { "id": "marlumotide", "name": "Marlumotide", "synonyms": [ "Marlumotida", "Wt-1 122 long", "Wt1-122a1 long" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314752", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314752/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "matrixyl", "name": "Matrixyl", "synonyms": [ "Matrixyl 3000", "Pal-KTTKS", "Palmitoyl Pentapeptide-3", "Palmitoyl Pentapeptide-4" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 18492182", "url": "https://pubmed.ncbi.nlm.nih.gov/18492182/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "matrixyl", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "mazdutide", "name": "Mazdutide", "synonyms": [ "Ibi-362", "Ibi362", "LY-3305677", "LY3305677", "Mazdutida" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5095358", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5095358/", "read": "2026-10-02" } ], "gpEntry": "mazdutide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2021, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "mecasermin", "name": "Mecasermin", "synonyms": [ "Increlex", "recombinant IGF-1", "rhIGF-1", "somatomedin C" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 40626687", "url": "https://pubmed.ncbi.nlm.nih.gov/40626687/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "mecasermin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "mecasermin-rinfabate", "name": "Mecasermin rinfabate", "synonyms": [ "IGF-1/IGFBP-3 complex", "iPlex", "rhIGF-1/rhIGFBP-3" ], "moleculeClass": "protein", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 28934640", "url": "https://pubmed.ncbi.nlm.nih.gov/28934640/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "mecasermin-rinfabate", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "melanin-concentrating-hormone", "name": "Melanin-concentrating hormone", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P20382", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P20382/entry", "note": "mature peptide 147-165 of Pro-MCH" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "DFDMLRCMLGRVYRPCWQV" }, { "id": "melanocyte-stimulating-hormone-alpha", "name": "Melanocyte-stimulating hormone alpha", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01189", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01189/entry", "note": "mature peptide 138-150 of Pro-opiomelanocortin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "SYSMEHFRWGKPV" }, { "id": "melanocyte-stimulating-hormone-beta", "name": "Melanocyte-stimulating hormone beta", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01189", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01189/entry", "note": "mature peptide 217-234 of Pro-opiomelanocortin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "DEGPYRMEHFRWGSPPKD" }, { "id": "melanotan-ii", "name": "Melanotan II", "synonyms": [ "Barbie drug", "MT-2", "MT-II", "MT2", "melanotan 2" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 8637402", "url": "https://pubmed.ncbi.nlm.nih.gov/8637402/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "melanotan-ii", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "melanotropin-gamma", "name": "Melanotropin gamma", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01189", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01189/entry", "note": "mature peptide 77-87 of Pro-opiomelanocortin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "YVMGHFRWDRF" }, { "id": "melatonin", "name": "Melatonin", "synonyms": [ "5-methoxy-N-acetyltryptamine", "Circadin", "MT", "N-acetyl-5-methoxytryptamine" ], "moleculeClass": "small-molecule", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 17875243", "url": "https://pubmed.ncbi.nlm.nih.gov/17875243/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "melatonin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "melittin", "name": "Melittin", "synonyms": [ "Apis mellifera peptide", "Bee venom peptide" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 4113805", "url": "https://pubmed.ncbi.nlm.nih.gov/4113805/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "melittin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "menotropin", "name": "Menotropin", "synonyms": [ "Humegon", "Menopur", "Repronex", "hMG", "highly purified hMG", "human menopausal gonadotropin" ], "moleculeClass": "protein", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 22244781", "url": "https://pubmed.ncbi.nlm.nih.gov/22244781/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "menotropin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "mertiatide", "name": "Mertiatide", "synonyms": [ "Mercaptoacetylglycylglycylglycine", "Mercaptoacetyltriglycine", "Mertiatida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL1615778", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1615778/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "met-enkephalin-arg-gly-leu", "name": "Met-enkephalin-Arg-Gly-Leu", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01210", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01210/entry", "note": "mature peptide 186-193 of Proenkephalin-A" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "YGGFMRGL" }, { "id": "met-enkephalin-arg-phe", "name": "Met-enkephalin-Arg-Phe", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01210", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01210/entry", "note": "mature peptide 261-267 of Proenkephalin-A" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "YGGFMRF" }, { "id": "methylene-blue", "name": "Methylene Blue", "synonyms": [], "moleculeClass": "small-molecule", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 6099", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/6099", "read": "2026-10-02", "note": "PubChem title: Methylene Blue" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "mgf", "name": "MGF", "synonyms": [ "IGF-1 Ec variant", "IGF-1Ec", "Mechano Growth Factor" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 32772171", "url": "https://pubmed.ncbi.nlm.nih.gov/32772171/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "mgf", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "mibenratide", "name": "Mibenratide", "synonyms": [ "JNJ-54452840", "Jnj-54452840", "Mibenratida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297617", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297617/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "micafungin", "name": "Micafungin", "synonyms": [ "Micafungin In Sodium Chloride 0.9%" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2023, "sources": [ { "type": "openfda", "id": "NDA216142", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=216142", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "micafungin", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "mifamurtide", "name": "Mifamurtide", "synonyms": [ "CGP-19835", "L-MTP-PE", "MIFAMURTIDE", "Mepact", "Mifamurtida", "Mifamurtide", "Mifamurtide free acid anhydrous", "Mifamurtide sodium hydrate", "Mifamurtide sodium salt monohydrate", "Sodium mifamurtide" ], "moleculeClass": "peptide-conjugate", "status": "approved", "maxPhase": 4.0, "firstApproval": 2009, "sources": [ { "type": "chembl", "id": "CHEMBL2111100", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2111100/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL2107354", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2107354/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "mifamurtide", "gpMatch": "alias", "innStem": "-tide", "usanYear": 2005, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "mifomelatide", "name": "Mifomelatide", "synonyms": [ "Mifomelatida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068142", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068142/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "milpocitide", "name": "Milpocitide", "synonyms": [], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314692", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314692/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "mk-677", "name": "MK-677", "synonyms": [ "Ibutamoren", "Ibutamoren mesylate", "LUM-201", "MK-0677", "MK0677", "Nutrobal" ], "moleculeClass": "small-molecule", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 8940347", "url": "https://pubmed.ncbi.nlm.nih.gov/8940347/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "mk-677", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "mod-grf-1-29", "name": "Mod GRF 1-29", "synonyms": [ "CJC-1295 no DAC", "CJC-1295 without DAC", "Modified GRF(1-29)", "Sermorelin analog" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 16822960", "url": "https://pubmed.ncbi.nlm.nih.gov/16822960/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "mod-grf-1-29", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "modimelanotide", "name": "Modimelanotide", "synonyms": [ "ABT-719", "Ap-214", "Ap214", "Modimelanotida", "ZP-1480", "ZP1480" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3545104", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3545104/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "montirelin", "name": "Montirelin", "synonyms": [ "CG-3703", "CNK-602A", "Montirelina", "Montireline", "NS-3" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2304039", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2304039/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-relin", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{[X751].[dH].P.[am]}$$$$", "sequence": null }, { "id": "motilin", "name": "Motilin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P12872", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P12872/entry", "note": "mature peptide 26-47 of Promotilin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "FVPIFTYGELQRMQEKERNKGQ" }, { "id": "motilin-associated-peptide", "name": "Motilin-associated peptide", "synonyms": [], "moleculeClass": "protein", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P12872", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P12872/entry", "note": "mature peptide 50-115 of Promotilin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "SLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK" }, { "id": "motixafortide", "name": "Motixafortide", "synonyms": [ "4F-BENZOYL-TN-14003", "4F-benzoyl-TN14003", "Aphexda", "BKT-140", "BKT140", "BL-8040", "BL-8040 acetate", "Bkt140", "Bl 8040", "Motixafortida", "T140", "TF 14016", "TF-14016", "TF-14016 ACETATE", "TF14016" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2023, "sources": [ { "type": "chembl", "id": "CHEMBL5095030", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5095030/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL5095449", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5095449/", "read": "2026-10-02", "note": "separate ChEMBL record of the same molecule" } ], "gpEntry": "motixafortide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2021, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "mots-c", "name": "MOTS-c", "synonyms": [ "Mitochondrial ORF of 12S rRNA-c" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 25738459", "url": "https://pubmed.ncbi.nlm.nih.gov/25738459/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "mots-c", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "murabutide", "name": "Murabutide", "synonyms": [ "Murabutida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL1908312", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1908312/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "muramyl-dipeptide", "name": "Muramyl Dipeptide", "synonyms": [ "Acetylmuramyl-alanyl-isoglutamine", "Mdp (adjuvant)", "N-acetylmuramyl dipeptide" ], "moleculeClass": "peptide", "status": "phase-1", "maxPhase": 1.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL1779325", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1779325/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "myristoyl-hexapeptide-16", "name": "Myristoyl Hexapeptide-16", "synonyms": [], "moleculeClass": "peptide-conjugate", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 163285863", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/163285863", "read": "2026-10-02", "note": "PubChem title: Myristoyl Hexapeptide-16" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "myristoyl-pentapeptide-17", "name": "Myristoyl Pentapeptide-17", "synonyms": [], "moleculeClass": "peptide-conjugate", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 127264611", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/127264611", "read": "2026-10-02", "note": "PubChem title: Myristoyl Pentapeptide-17" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "n-acetyl-semax", "name": "N-acetyl Semax", "synonyms": [ "N-acetyl semax amidate" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 172638603", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/172638603", "read": "2026-10-02", "note": "PubChem title: N-acetyl semax amidate" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "nacartocin", "name": "Nacartocin", "synonyms": [ "Nacartocina", "Nacartocine" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2218901", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2218901/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tocin", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "nad-plus", "name": "NAD+", "synonyms": [ "NAD plus", "Nicotinamide Adenine Dinucleotide", "β-nicotinamide adenine dinucleotide" ], "moleculeClass": "small-molecule", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 29514064", "url": "https://pubmed.ncbi.nlm.nih.gov/29514064/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "nad-plus", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "nafarelin", "name": "Nafarelin", "synonyms": [ "Lhrh, 6(d-nal(2))", "Nafarelin acetate anhydrous", "Nafarelina", "Nafareline", "Nasanyl", "RS-94991", "RS-94991-298", "Synarel" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1990, "sources": [ { "type": "chembl", "id": "CHEMBL1201309", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1201309/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL1200671", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1200671/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "nafarelin", "gpMatch": "name", "innStem": "-relin", "usanYear": 1984, "chemblType": "Protein", "helm": "PEPTIDE1{[Glp].H.W.S.Y.[d1-Nal].L.R.P.G.[am]}$$$$", "sequence": null }, { "id": "nangibotide", "name": "Nangibotide", "synonyms": [ "LR-12", "LR12", "Motrem", "Nangibotida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297793", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297793/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "navepegritide", "name": "Navepegritide", "synonyms": [ "Navepegritida", "Transcon cnp", "Transcon cnp-38" ], "moleculeClass": "peptide-conjugate", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4594507", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4594507/", "read": "2026-10-02" } ], "gpEntry": "navepegritide", "gpMatch": "name", "innStem": "-peg-; -tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "nendratareotide-uzatansine", "name": "Nendratareotide Uzatansine", "synonyms": [ "Pen-221" ], "moleculeClass": "peptide", "status": "phase-1", "maxPhase": 1.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4650335", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4650335/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tansine; -tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "nerinetide", "name": "Nerinetide", "synonyms": [ "FN-023", "FN023", "NA-1", "NA-1 acetate", "NA-1 hydrochloride", "Nerinetida", "TAT-NR2B9C HYDROCHLORIDE", "Tat-nr2b9c" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL502630", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL502630/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL4594282", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4594282/", "read": "2026-10-02", "note": "salt form, folded into this row" }, { "type": "chembl", "id": "CHEMBL4594283", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4594283/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "nerinetide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2019, "chemblType": "Protein", "helm": "PEPTIDE1{Y.G.R.K.K.R.R.Q.R.R.R.K.L.S.S.I.E.S.D.V}$$$$", "sequence": null }, { "id": "nesiritide", "name": "Nesiritide", "synonyms": [ "Bnp-32", "Brain natriuretic peptide 32", "C01DX19", "Natrecor", "Nesiritida", "Nesiritide recombinant" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2001, "sources": [ { "type": "chembl", "id": "CHEMBL1201668", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1201668/", "read": "2026-10-02" }, { "type": "uniprot", "id": "P16860", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P16860/entry", "note": "mature peptide 103-134 of Natriuretic peptides B" }, { "type": "chembl", "id": "CHEMBL2109183", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2109183/", "read": "2026-10-02", "note": "separate ChEMBL record of the same molecule" } ], "gpEntry": "nesiritide", "gpMatch": "name", "innStem": "-tide", "usanYear": 1998, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "neurokinin-a", "name": "Neurokinin A", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P20366", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P20366/entry", "note": "mature peptide 98-107 of Protachykinin-1" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "HKTDSFVGLM" }, { "id": "neurokinin-b", "name": "Neurokinin-B", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q9UHF0", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9UHF0/entry", "note": "mature peptide 81-90 of Tachykinin-3" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "DMHDFFVGLM" }, { "id": "neuromedin-b", "name": "Neuromedin-B", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P08949", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P08949/entry", "note": "mature peptide 47-56 of Neuromedin-B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "GNLWATGHFM" }, { "id": "neuromedin-b-32", "name": "Neuromedin-B-32", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P08949", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P08949/entry", "note": "mature peptide 25-56 of Neuromedin-B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "APLSWDLPEPRSRASKIRVHSRGNLWATGHFM" }, { "id": "neuromedin-precursor-related-peptide-33", "name": "Neuromedin precursor-related peptide 33", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P48645", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P48645/entry", "note": "mature peptide 104-136 of Neuromedin-U, 2 copies" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "FLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHE" }, { "id": "neuromedin-precursor-related-peptide-36", "name": "Neuromedin precursor-related peptide 36", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P48645", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P48645/entry", "note": "mature peptide 104-139 of Neuromedin-U, 2 copies" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "FLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRM" }, { "id": "neuromedin-s", "name": "Neuromedin-S", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q5H8A3", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q5H8A3/entry", "note": "mature peptide 109-141 of Neuromedin-S" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN" }, { "id": "neuromedin-u-25", "name": "Neuromedin-U-25", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P48645", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P48645/entry", "note": "mature peptide 142-166 of Neuromedin-U, 2 copies" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "FRVDEEFQSPFASQSRGYFLFRPRN" }, { "id": "neuronostatin", "name": "Neuronostatin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P61278", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P61278/entry", "note": "mature peptide 31-43 of Somatostatin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "LRQFLQKSLAAAA" }, { "id": "neuropeptide-af", "name": "Neuropeptide AF", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "O15130", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/O15130/entry", "note": "mature peptide 93-110 of Pro-FMRFamide-related neuropeptide FF" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "AGEGLNSQFWSLAAPQRF" }, { "id": "neuropeptide-b-23", "name": "Neuropeptide B-23", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q8NG41", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q8NG41/entry", "note": "mature peptide 25-48 of Neuropeptide B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "WYKPAAGHSSYSVGRAAGLLSGLR" }, { "id": "neuropeptide-b-29", "name": "Neuropeptide B-29", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q8NG41", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q8NG41/entry", "note": "mature peptide 25-53 of Neuropeptide B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "WYKPAAGHSSYSVGRAAGLLSGLRRSPYA" }, { "id": "neuropeptide-bam20", "name": "Neuropeptide BAM20", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01210", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01210/entry", "note": "mature peptide 210-229 of Proenkephalin-A" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "YGGFMRRVGRPEWWMDYQKR" }, { "id": "neuropeptide-bam22", "name": "Neuropeptide BAM22", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01210", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01210/entry", "note": "mature peptide 210-231 of Proenkephalin-A" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "YGGFMRRVGRPEWWMDYQKRYG" }, { "id": "neuropeptide-bam8-22", "name": "Neuropeptide BAM8-22", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01210", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01210/entry", "note": "mature peptide 217-231 of Proenkephalin-A" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "VGRPEWWMDYQKRYG" }, { "id": "neuropeptide-ff", "name": "Neuropeptide FF", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "O15130", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/O15130/entry", "note": "mature peptide 69-76 of Pro-FMRFamide-related neuropeptide FF" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "FLFQPQRF" }, { "id": "neuropeptide-gamma-1st-part", "name": "Neuropeptide gamma, 1st part", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P20366", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P20366/entry", "note": "mature peptide 72-73 of Protachykinin-1" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "DA" }, { "id": "neuropeptide-gamma-2nd-part", "name": "Neuropeptide gamma, 2nd part", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P20366", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P20366/entry", "note": "mature peptide 89-107 of Protachykinin-1" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "GHGQISHKRHKTDSFVGLM" }, { "id": "neuropeptide-glutamic-acid-isoleucine", "name": "Neuropeptide-glutamic acid-isoleucine", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P20382", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P20382/entry", "note": "mature peptide 131-143 of Pro-MCH" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "EIGDEENSAKFPI" }, { "id": "neuropeptide-glycine-glutamic-acid", "name": "Neuropeptide-glycine-glutamic acid", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P20382", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P20382/entry", "note": "mature peptide 110-128 of Pro-MCH" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "GSVAFPAENGVQNTESTQE" }, { "id": "neuropeptide-k", "name": "Neuropeptide K", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P20366", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P20366/entry", "note": "mature peptide 72-107 of Protachykinin-1" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM" }, { "id": "neuropeptide-npsf", "name": "Neuropeptide NPSF", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q9HCQ7", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9HCQ7/entry", "note": "mature peptide 56-92 of Pro-FMRFamide-related neuropeptide VF" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "SLNFEELKDWGPKNVIKMSTPAVNKMPHSFANLPLRF" }, { "id": "neuropeptide-npvf", "name": "Neuropeptide NPVF", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q9HCQ7", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9HCQ7/entry", "note": "mature peptide 124-131 of Pro-FMRFamide-related neuropeptide VF" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "VPNLPQRF" }, { "id": "neuropeptide-rfrp-1", "name": "Neuropeptide RFRP-1", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q9HCQ7", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9HCQ7/entry", "note": "mature peptide 81-92 of Pro-FMRFamide-related neuropeptide VF" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "MPHSFANLPLRF" }, { "id": "neuropeptide-rfrp-2", "name": "Neuropeptide RFRP-2", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q9HCQ7", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9HCQ7/entry", "note": "mature peptide 101-112 of Pro-FMRFamide-related neuropeptide VF" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "SAGATANLPLRS" }, { "id": "neuropeptide-s", "name": "Neuropeptide S", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P0C0P6", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P0C0P6/entry", "note": "mature peptide 70-89 of Neuropeptide S" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "SFRNGVGTGMKKTSFQRAKS" }, { "id": "neuropeptide-sf", "name": "Neuropeptide SF", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "O15130", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/O15130/entry", "note": "mature peptide 66-76 of Pro-FMRFamide-related neuropeptide FF" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "SQAFLFQPQRF" }, { "id": "neuropeptide-w-23", "name": "Neuropeptide W-23", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q8N729", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q8N729/entry", "note": "mature peptide 33-55 of Neuropeptide W" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "WYKHVASPRYHTVGRAAGLLMGL" }, { "id": "neuropeptide-w-30", "name": "Neuropeptide W-30", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q8N729", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q8N729/entry", "note": "mature peptide 33-62 of Neuropeptide W" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "WYKHVASPRYHTVGRAAGLLMGLRRSPYLW" }, { "id": "neuropeptide-y", "name": "Neuropeptide Y", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01303", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01303/entry", "note": "mature peptide 29-64 of Pro-neuropeptide Y" } ], "gpEntry": "neuropeptide-y", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY" }, { "id": "neurotensin", "name": "Neurotensin", "synonyms": [ "NT", "NTS" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 6132085", "url": "https://pubmed.ncbi.nlm.nih.gov/6132085/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "neurotensin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "nicotinamide-mononucleotide", "name": "Nicotinamide Mononucleotide", "synonyms": [], "moleculeClass": "small-molecule", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 14180", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/14180", "read": "2026-10-02", "note": "PubChem title: Nicotinamide Mononucleotide" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "nisin", "name": "Nisin", "synonyms": [ "Nisaplin", "Nisin A" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 18689718", "url": "https://pubmed.ncbi.nlm.nih.gov/18689718/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "nisin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "nisotirostide", "name": "Nisotirostide", "synonyms": [ "LY-3457263", "LY3457263", "Ly3457263", "Nisostirotide", "Nisotirostida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5315028", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5315028/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2023, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "nociceptin", "name": "Nociceptin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q13519", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q13519/entry", "note": "mature peptide 130-146 of Prepronociceptin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "FGGFTGARKSARKLANQ" }, { "id": "nocistatin", "name": "Nocistatin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q13519", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q13519/entry", "note": "mature peptide 98-127 of Prepronociceptin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ" }, { "id": "nonapeptide-1", "name": "Nonapeptide-1", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 10418849", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/10418849", "read": "2026-10-02", "note": "PubChem title: Nonapeptide-1" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "noopept", "name": "Noopept", "synonyms": [ "GVS-111", "N-phenylacetyl-L-prolylglycine ethyl ester", "Omberacetam" ], "moleculeClass": "peptidomimetic", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 22500312", "url": "https://pubmed.ncbi.nlm.nih.gov/22500312/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "noopept", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "noraramtide", "name": "Noraramtide", "synonyms": [ "BHV-1100", "KP-1237", "KP1237", "Noraramtida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068397", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068397/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2023, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "norleusactide", "name": "Norleusactide", "synonyms": [ "DW 75", "DW-75", "Norleusactida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2103941", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2103941/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{[dS].Y.S.[dNle].E.[dH].[dF].R.W.G.[dK].P.V.G.K.[dK].R.[dR].P.V.[dK].V.[dY].P.V.[am]}$$$$", "sequence": null }, { "id": "nosiheptide", "name": "Nosiheptide", "synonyms": [ "NSC-307240", "Nosiheptida", "RP 9671", "RP-9671" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2103750", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2103750/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 1978, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "npas3-peptide", "name": "NPAS3 Research Peptide", "synonyms": [ "Neuronal PAS domain protein 3 fragment" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 12746393", "url": "https://pubmed.ncbi.nlm.nih.gov/12746393/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "npas3-peptide", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "npp", "name": "NPP", "synonyms": [], "moleculeClass": "protein", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01189", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01189/entry", "note": "mature peptide 27-102 of Pro-opiomelanocortin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "WCLESSQCQDLTTESNLLECIRACKPDLSAETPMFPGNGDEQPLTENPRKYVMGHFRWDRFGRRNSSSSGSSGAGQ" }, { "id": "obestatin", "name": "Obestatin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q9UBU3", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9UBU3/entry", "note": "mature peptide 76-98 of Appetite-regulating hormone" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "FNAPFDVGIKLSGVQYQQHSQAL" }, { "id": "obinepitide", "name": "Obinepitide", "synonyms": [ "Obinepitida", "TM-30338", "TM30338" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108338", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108338/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "ociltide", "name": "Ociltide", "synonyms": [ "Ociltida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297081", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297081/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "octapeptide-2", "name": "Octapeptide-2", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 16657324", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/16657324", "read": "2026-10-02", "note": "PubChem title: Octapeptide-2" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "octreotide", "name": "Octreotide", "synonyms": [ "Bynfezia pen", "CAM-2029", "CAM2029", "Mycapssa", "Octreolin", "Octreotida", "Octreotide (as acetate)", "Octreotide acetate (preservative free)", "Octreotide acetate preservative free", "Octreotide hydrochloride, (-)-", "SMS 201-995", "SMS 201-995 AC", "SMS 201-995 PA", "SMS PA", "SMS-201-995", "SMS-201-995 AC", "SMS-201-995 PA", "SMS-201995-AC", "SMS-995", "SMS-995-AAA", "SMS-PA", "SMS995", "SMS995-AAA", "Sandostatin", "Sandostatin lar" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1988, "sources": [ { "type": "chembl", "id": "CHEMBL1680", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1680/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL1200480", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1200480/", "read": "2026-10-02", "note": "salt form, folded into this row" }, { "type": "chembl", "id": "CHEMBL2105834", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2105834/", "read": "2026-10-02", "note": "salt form, folded into this row" }, { "type": "chembl", "id": "CHEMBL3545066", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3545066/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "octreotide", "gpMatch": "name", "innStem": "-tide", "usanYear": 1987, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "olatorepatide", "name": "Olatorepatide", "synonyms": [ "Olatorepatida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068153", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068153/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "oligopeptide-68", "name": "Oligopeptide-68", "synonyms": [ "H-Gly-Arg-Gly-Asp-Tyr-Ile-Trp-Ser-Leu-Asp-Thr-Gln-OH" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 163285842", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/163285842", "read": "2026-10-02", "note": "PubChem title: H-Gly-Arg-Gly-Asp-Tyr-Ile-Trp-Ser-Leu-Asp-Thr-Gln-OH" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "omiganan", "name": "Omiganan", "synonyms": [ "CLS001", "MBI-226", "MX-594AN", "Omiganan pentahydrochloride", "Omigard" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 33010325", "url": "https://pubmed.ncbi.nlm.nih.gov/33010325/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "omiganan", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "omramotide", "name": "Omramotide", "synonyms": [ "Omramotida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314855", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314855/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "onvitrelin-ucalontide", "name": "Onvitrelin Ucalontide", "synonyms": [ "EP-100", "EP-100 (PEPTIDE)", "EP100", "Ep 100", "Ep-100", "Onvitrelina ucalontida", "Onvitreline ucalontide", "Ucalolictide" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297748", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297748/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-relin; -tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "orexin-a", "name": "Orexin-A", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "O43612", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/O43612/entry", "note": "mature peptide 34-66 of Hypocretin neuropeptide precursor" } ], "gpEntry": "orexin-a", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "QPLPDCCRQKTCSCRLYELLHGAGNHAAGILTL" }, { "id": "orexin-b", "name": "Orexin-B", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "O43612", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/O43612/entry", "note": "mature peptide 70-97 of Hypocretin neuropeptide precursor" } ], "gpEntry": "orexin-b", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "RSGPPGLQGRLQRLLQASGNHAAGILTM" }, { "id": "orforglipron", "name": "Orforglipron", "synonyms": [ "LY3502970", "OWL833" ], "moleculeClass": "small-molecule", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 40960239", "url": "https://pubmed.ncbi.nlm.nih.gov/40960239/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "orforglipron", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "oritavancin", "name": "Oritavancin", "synonyms": [ "Kimyrsa" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2021, "sources": [ { "type": "openfda", "id": "NDA214155", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=214155", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "oritavancin", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "ornipressin", "name": "Ornipressin", "synonyms": [ "8-l-ornithinevasopressin", "8-ornithinevasopressin", "Orn(8)-vasopressin", "Ornipresina", "Ornipressine", "POR 8", "POR-8", "Por 8 sandoz" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL1819440", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1819440/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-pressin", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{C.Y.F.Q.N.C.P.[Orn].G.[am]}$PEPTIDE1,PEPTIDE1,6:R3-1:R3$$$", "sequence": null }, { "id": "orotirelin", "name": "Orotirelin", "synonyms": [ "Cg-3509", "Cg3509", "Orotirelina", "Orotireline" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2105278", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2105278/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-relin", "usanYear": null, "chemblType": "Small molecule", "helm": "PEPTIDE1{[X2542].H.P.[am]}$$$$", "sequence": null }, { "id": "orphanin-fq2", "name": "Orphanin FQ2", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q13519", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q13519/entry", "note": "mature peptide 149-165 of Prepronociceptin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "FSEFMRQYLVLSMQSSQ" }, { "id": "osteostatin", "name": "Osteostatin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P12272", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P12272/entry", "note": "mature peptide 143-175 of Parathyroid hormone-related protein" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "TRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR" }, { "id": "ovagen", "name": "Ovagen", "synonyms": [ "EDL tripeptide", "Glu-Asp-Leu" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 23734519", "url": "https://pubmed.ncbi.nlm.nih.gov/23734519/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "ovagen", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "ovemotide", "name": "Ovemotide", "synonyms": [ "(leu27)-melan-a, mart 1 (26-35)", "Elagigiltv", "Gp100:280-288(288v) peptide", "MPS-21", "Mart-1:26-35(27l) peptide", "Melan-a(aa26-35*a27l))", "Ovemotida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL263441", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL263441/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2005, "chemblType": "Protein", "helm": "PEPTIDE1{Y.L.E.P.G.P.V.T.V}$$$$", "sequence": null }, { "id": "oximbomotide", "name": "Oximbomotide", "synonyms": [ "Oximbomotida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314861", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314861/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "oxyntomodulin", "name": "Oxyntomodulin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01275", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01275/entry", "note": "mature peptide 53-89 of Pro-glucagon" } ], "gpEntry": "oxyntomodulin", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA" }, { "id": "oxytocin", "name": "Oxytocin", "synonyms": [ "Alpha-hypophamine", "Endopituitrina", "Intertocine s", "Orasthin", "Oxitocina", "Oxytocine", "Oxytocinum", "Pitocin", "Syntocinon", "Syntometrine", "TNX-1900", "TNX1900", "TTA-121" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1980, "sources": [ { "type": "chembl", "id": "CHEMBL395429", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL395429/", "read": "2026-10-02" }, { "type": "openfda", "id": "NDA018248", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=018248", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" }, { "type": "uniprot", "id": "P01178", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01178/entry", "note": "mature peptide 20-28 of Oxytocin-neurophysin 1 proprotein" } ], "gpEntry": "oxytocin", "gpMatch": "name", "innStem": "-tocin", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{C.Y.I.Q.N.C.P.L.G.[am]}$PEPTIDE1,PEPTIDE1,6:R3-1:R3$$$", "sequence": null }, { "id": "ozarelix", "name": "Ozarelix", "synonyms": [ "D-63153", "D63153" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108312", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108312/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-relix", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "p21", "name": "P21", "synonyms": [ "Cerebrolysin-derived peptide 21", "Cognitive enhancer peptide-21" ], "moleculeClass": "peptidomimetic", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 22083255", "url": "https://pubmed.ncbi.nlm.nih.gov/22083255/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "p21", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "pacap", "name": "PACAP", "synonyms": [ "PACAP-27", "PACAP-38", "PACAP38", "Pituitary adenylate cyclase-activating polypeptide" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 40229719", "url": "https://pubmed.ncbi.nlm.nih.gov/40229719/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "pacap", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "pacap-related-peptide", "name": "PACAP-related peptide", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P18509", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P18509/entry", "note": "mature peptide 82-129 of Pituitary adenylate cyclase-activating polypeptide, 2 copies" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "DVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLS" }, { "id": "pal-ghk", "name": "Pal-GHK", "synonyms": [ "Pal-Gly-His-Lys", "Palmitoyl Oligopeptide", "Palmitoyl Tripeptide-1" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 20729942", "url": "https://pubmed.ncbi.nlm.nih.gov/20729942/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "pal-ghk", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "palmitoyl-dipeptide-5-diaminobutyroyl-hydroxythreonine", "name": "Palmitoyl Dipeptide-5 Diaminobutyroyl Hydroxythreonine", "synonyms": [ "Palmitoyllysylvalyldiaminobutyroylthreonine" ], "moleculeClass": "peptide-conjugate", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 72941935", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/72941935", "read": "2026-10-02", "note": "PubChem title: Palmitoyllysylvalyldiaminobutyroylthreonine" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "palmitoyl-hexapeptide-12", "name": "Palmitoyl Hexapeptide-12", "synonyms": [ "Biopeptide EL", "Elastin spring-fragment peptide", "Pal-VGVAPG", "Pal-Val-Gly-Val-Ala-Pro-Gly" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 6903189", "url": "https://pubmed.ncbi.nlm.nih.gov/6903189/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "palmitoyl-hexapeptide-12", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "palmitoyl-pentapeptide-4", "name": "Palmitoyl Pentapeptide-4", "synonyms": [ "Matrixyl", "Pal-KTTKS" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 18492182", "url": "https://pubmed.ncbi.nlm.nih.gov/18492182/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "palmitoyl-pentapeptide-4", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "palmitoyl-tetrapeptide-10", "name": "Palmitoyl Tetrapeptide-10", "synonyms": [], "moleculeClass": "peptide-conjugate", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 24967468", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/24967468", "read": "2026-10-02", "note": "PubChem title: Palmitoyl tetrapeptide-10" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "palmitoyl-tetrapeptide-7", "name": "Palmitoyl Tetrapeptide-7", "synonyms": [ "Pal-GQPR", "Pal-Gly-Gln-Pro-Arg", "Palmitoyl Tetrapeptide-3", "Rigin", "Rigin Palmitoyl" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 7309346", "url": "https://pubmed.ncbi.nlm.nih.gov/7309346/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "palmitoyl-tetrapeptide-7", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "palmitoyl-tripeptide-38", "name": "Palmitoyl Tripeptide-38", "synonyms": [ "Matrixyl S6", "Matrixyl Synthe'6", "Pal-KMO2K", "Pal-Lys-Met(O2)-Lys" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 33195061", "url": "https://pubmed.ncbi.nlm.nih.gov/33195061/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "palmitoyl-tripeptide-38", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "palmitoyl-tripeptide-5", "name": "Palmitoyl Tripeptide-5", "synonyms": [ "Pal-KVK", "Pal-Lys-Val-Lys", "SYN-COLL", "Syn-Coll" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 10708953", "url": "https://pubmed.ncbi.nlm.nih.gov/10708953/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "palmitoyl-tripeptide-5", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "palopegteriparatide", "name": "Palopegteriparatide", "synonyms": [ "ACP-014", "Mpeg 40000-teriparatide", "TransCon PTH", "Transcon pth (1-34)", "Yorvipath" ], "moleculeClass": "peptide-conjugate", "status": "approved", "maxPhase": 4.0, "firstApproval": 2023, "sources": [ { "type": "chembl", "id": "CHEMBL5095475", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5095475/", "read": "2026-10-02" } ], "gpEntry": "palopegteriparatide", "gpMatch": "name", "innStem": "-peg-; -tide", "usanYear": 2022, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "paluratide", "name": "Paluratide", "synonyms": [ "Paluratida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068161", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068161/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "pancragen", "name": "Pancragen", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 18642713", "url": "https://pubmed.ncbi.nlm.nih.gov/18642713/", "read": "2026-10-02", "note": "earliest PubMed record naming Pancragen in its title (2007): Effect of pancragen on blood glucose level, capillary permeability and adhesion in rats with experimental diabetes melli" } ], "gpEntry": "pancragen", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "pancreatic-icosapeptide", "name": "Pancreatic icosapeptide", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01298", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01298/entry", "note": "mature peptide 69-88 of Pancreatic polypeptide prohormone" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "HKEDTLAFSEWGSPHAAVPR" }, { "id": "pancreatic-polypeptide", "name": "Pancreatic Polypeptide", "synonyms": [ "Human pancreatic polypeptide", "Pancreatic hormone iii", "Pancreatic polypeptide (human)", "Pancreatic polypeptide human" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4540843", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4540843/", "read": "2026-10-02" }, { "type": "uniprot", "id": "P01298", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01298/entry", "note": "mature peptide 30-65 of Pancreatic polypeptide prohormone" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "pareptide", "name": "Pareptide", "synonyms": [ "AY-24,856", "AY-24856", "Pareptida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2111011", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2111011/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL2107041", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2107041/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 1977, "chemblType": "Protein", "helm": "PEPTIDE1{P.[Me_dL].G.[am]}$$$$", "sequence": null }, { "id": "pasireotide", "name": "Pasireotide", "synonyms": [ "PASIREOTIDE DIASPARTATE", "Pasireotida", "Pasireotide (as diaspartate)", "Pasireotide diaspartate", "SOM 230", "SOM-230", "SOM-230 PAMOATE", "SOM230", "SOM230 PAMOATE", "Signifor", "Signifor lar", "Signifor lar kit" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2012, "sources": [ { "type": "chembl", "id": "CHEMBL3349607", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3349607/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL5314380", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314380/", "read": "2026-10-02", "note": "salt form, folded into this row" }, { "type": "chembl", "id": "CHEMBL5314382", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314382/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "pasireotide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2011, "chemblType": "Protein", "helm": "PEPTIDE1{[X1776].[Phg].[dW].K.[Tyr(Bzl)].F}$PEPTIDE1,PEPTIDE1,6:R2-1:R1$$$", "sequence": null }, { "id": "pb-718", "name": "PB-718", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "clinicaltrials", "id": "NCT05021666", "url": "https://clinicaltrials.gov/study/NCT05021666", "read": "2026-10-02", "note": "trial registration cited on the encyclopedia entry" } ], "gpEntry": "pb-718", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "pe-22-28", "name": "PE-22-28", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 20405001", "url": "https://pubmed.ncbi.nlm.nih.gov/20405001/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "pe-22-28", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "peforelin", "name": "Peforelin", "synonyms": [ "Gnrh iii", "Lamprey lh-rh iii", "Maprelin xp10", "Peforelina", "Peforeline" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108043", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108043/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-relin", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "peg-mgf", "name": "PEG-MGF", "synonyms": [ "PEG Mechano Growth Factor", "PEGylated mechano-growth factor", "Pegylated MGF" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 16024511", "url": "https://pubmed.ncbi.nlm.nih.gov/16024511/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "peg-mgf", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "pegapamodutide", "name": "Pegapamodutide", "synonyms": [ "LY-2944876", "LY2944876", "Pegapamodutida" ], "moleculeClass": "peptide-conjugate", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3990012", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3990012/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "peg-; -tide", "usanYear": 2016, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "pegcetacoplan", "name": "Pegcetacoplan", "synonyms": [ "Empaveli", "Syfovre" ], "moleculeClass": "peptide-conjugate", "status": "approved", "maxPhase": 4.0, "firstApproval": 2021, "sources": [ { "type": "openfda", "id": "NDA215014", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=215014", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "pegcetacoplan", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "peginesatide", "name": "Peginesatide", "synonyms": [ "AF 37702 ACETATE", "AF-37702", "AF-37702 ACETATE", "AF37702", "AF37702 ACETATE", "Hematide", "Hematide acetate", "Omontys", "Omontys preservative free", "Peginesatida" ], "moleculeClass": "peptide-conjugate", "status": "withdrawn", "maxPhase": 4.0, "firstApproval": 2012, "sources": [ { "type": "chembl", "id": "CHEMBL2107866", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2107866/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL1963684", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1963684/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": null, "gpMatch": null, "innStem": "peg-; -tide", "usanYear": 2010, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "pegloprastide", "name": "Pegloprastide", "synonyms": [ "AVB-620", "AVB620" ], "moleculeClass": "peptide-conjugate", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5095310", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5095310/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "peg-; -tide", "usanYear": 2021, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "pegloxenatide", "name": "Pegloxenatide", "synonyms": [ "PEX-168", "PEX168", "Peg-40 kd-loxenatide", "Pex168" ], "moleculeClass": "peptide-conjugate", "status": "phase-1", "maxPhase": 1.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4802213", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4802213/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "peg-; -tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "pegmispotide", "name": "Pegmispotide", "synonyms": [ "BT-051", "BT051", "Pegmispotida" ], "moleculeClass": "peptide-conjugate", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314863", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314863/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "peg-; -tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "pegsebrenatide", "name": "Pegsebrenatide", "synonyms": [ "NLY-01", "NLY01", "Nly-01", "Nly01", "Pegsebrenatida" ], "moleculeClass": "peptide-conjugate", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4650495", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4650495/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "peg-; -tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "pegvisomant", "name": "Pegvisomant", "synonyms": [ "B2036-PEG", "Somavert" ], "moleculeClass": "protein", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 10770982", "url": "https://pubmed.ncbi.nlm.nih.gov/10770982/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "pegvisomant", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "pemvidutide", "name": "Pemvidutide", "synonyms": [ "ALT-801", "MD-1373", "Pemvidutida", "SP-1373" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5095142", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5095142/", "read": "2026-10-02" } ], "gpEntry": "pemvidutide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2023, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "pen", "name": "PEN", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q9UHG2", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9UHG2/entry", "note": "mature peptide 221-242 of ProSAAS" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "AADHDVGSELPPEGVLGALLRV" }, { "id": "pendetide", "name": "Pendetide", "synonyms": [ "Gyk-dtpa", "Pendetida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108754", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108754/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Unknown", "helm": null, "sequence": null }, { "id": "penk-114-133", "name": "PENK(114-133)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01210", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01210/entry", "note": "mature peptide 114-133 of Proenkephalin-A" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "MDELYPMEPEEEANGSEILA" }, { "id": "penk-143-183", "name": "PENK(143-183)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01210", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01210/entry", "note": "mature peptide 143-183 of Proenkephalin-A" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVS" }, { "id": "penk-237-258", "name": "PENK(237-258)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01210", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01210/entry", "note": "mature peptide 237-258 of Proenkephalin-A" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "FAEALPSDEEGESYSKEVPEME" }, { "id": "pentagastrin", "name": "Pentagastrin", "synonyms": [ "AY-6608", "ICI 50,123", "ICI-50123", "NSC-367746", "Pentagastrina", "Pentagastrine", "Peptavlon" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1974, "sources": [ { "type": "chembl", "id": "CHEMBL1328", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1328/", "read": "2026-10-02" } ], "gpEntry": "pentagastrin", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "pentapeptide-3", "name": "Pentapeptide-3", "synonyms": [ "GPRPA", "Gly-Pro-Arg-Pro-Ala-NH2", "Pentapeptide-3V", "Vialox" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 9305882", "url": "https://pubmed.ncbi.nlm.nih.gov/9305882/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "pentapeptide-3", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "pentetreotide", "name": "Pentetreotide", "synonyms": [ "(-)-pentetoreotide", "DTPA-SMS", "Pentetoreotide", "Pentetreotida", "SDZ 215-811", "SDZ 215-811S", "SDZ-215-811", "SDZ-215-811S", "SDZ-215811" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108757", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108757/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "pentigetide", "name": "Pentigetide", "synonyms": [ "Asp-ser-asp-pro-arg", "HEP-P", "HEPP", "Human ige pentapeptide", "IGE PENTAPEPTIDE", "PENTAPEPTIDE DSDPR", "PENTAPEPTIDE-DSDPR", "Pentigetida", "Pentyde" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2304033", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2304033/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 1988, "chemblType": "Protein", "helm": "PEPTIDE1{D.[dS].D.P.[dR]}$$$$", "sequence": null }, { "id": "pepitem", "name": "PEPITEM", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 32169847", "url": "https://pubmed.ncbi.nlm.nih.gov/32169847/", "read": "2026-10-02", "note": "earliest PubMed record naming PEPITEM in its title (2020): PEPITEM/Cadherin 15 Axis Inhibits T Lymphocyte Infiltration and Glomerulonephritis in a Mouse Model of Systemic Lupus Er" } ], "gpEntry": "pepitem", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "peptide-b27pd", "name": "Peptide B27pd", "synonyms": [ "Alnedlsswtaadt", "Amino acids 125-138 of hla-b", "B-27PD", "B27PD", "B27pd", "Optiquel" ], "moleculeClass": "peptide", "status": "phase-1", "maxPhase": 1.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297903", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297903/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "peptide-t", "name": "Peptide T", "synonyms": [], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL180971", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL180971/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{A.S.T.T.T.N.Y.T}$$$$", "sequence": null }, { "id": "petrelintide", "name": "Petrelintide", "synonyms": [ "Petrelintida", "ZP-8396", "Zp8396" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314864", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314864/", "read": "2026-10-02" } ], "gpEntry": "petrelintide", "gpMatch": "name", "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "pexiganan", "name": "Pexiganan", "synonyms": [ "Locilex", "MSI-78" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 18990064", "url": "https://pubmed.ncbi.nlm.nih.gov/18990064/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "pexiganan", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "pezadeftide", "name": "Pezadeftide", "synonyms": [ "Pezadeftida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5095144", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5095144/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "pimelautide", "name": "Pimelautide", "synonyms": [ "Pimelautida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3989437", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3989437/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "pinealon", "name": "Pinealon", "synonyms": [ "EDR tripeptide", "Glu-Asp-Arg" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 21978084", "url": "https://pubmed.ncbi.nlm.nih.gov/21978084/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "pinealon", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "pituitary-adenylate-cyclase-activating-polypeptide-27", "name": "Pituitary adenylate cyclase-activating polypeptide 27", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P18509", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P18509/entry", "note": "mature peptide 132-158 of Pituitary adenylate cyclase-activating polypeptide, 2 copies" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "HSDGIFTDSYSRYRKQMAVKKYLAAVL" }, { "id": "pituitary-adenylate-cyclase-activating-polypeptide-38", "name": "Pituitary adenylate cyclase-activating polypeptide 38", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P18509", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P18509/entry", "note": "mature peptide 132-169 of Pituitary adenylate cyclase-activating polypeptide, 2 copies" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK" }, { "id": "plecanatide", "name": "Plecanatide", "synonyms": [ "Guanilib", "Plecanatida", "SP-304", "SP-304 (SYNERGY)", "Trulance" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2017, "sources": [ { "type": "chembl", "id": "CHEMBL2103867", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2103867/", "read": "2026-10-02" } ], "gpEntry": "plecanatide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2010, "chemblType": "Protein", "helm": "PEPTIDE1{N.D.E.C.E.L.C.V.N.V.A.C.T.G.C.L}$PEPTIDE1,PEPTIDE1,12:R3-4:R3|PEPTIDE1,PEPTIDE1,15:R3-7:R3$$$", "sequence": null }, { "id": "pnc-27", "name": "PNC-27", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 20080680", "url": "https://pubmed.ncbi.nlm.nih.gov/20080680/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "pnc-27", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "pobrolitide", "name": "Pobrolitide", "synonyms": [ "Pobrolitida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314865", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314865/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "polymyxin-b", "name": "Polymyxin B", "synonyms": [ "Bacitracin Zinc And Polymyxin B Sulfate", "Dexasporin", "Maxitrol", "Neomycin And Polymyxin B Sulfate", "Neomycin And Polymyxin B Sulfates And Bacitracin Zinc", "Neomycin And Polymyxin B Sulfates And Dexamethasone", "Neomycin And Polymyxin B Sulfates And Gramicidin", "Neomycin And Polymyxin B Sulfates And Hydrocortisone", "Neomycin And Polymyxin B Sulfates, Bacitracin Zinc And Hydrocortisone", "Oticair", "Trimethoprim Sulfate And Polymyxin B Sulfate" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1983, "sources": [ { "type": "openfda", "id": "ANDA062423", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=062423", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "polymyxin-b", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "posatirelin", "name": "Posatirelin", "synonyms": [ "Posatirelina", "Posatireline" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2105243", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2105243/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-relin", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{[X22].L.P.[am]}$$$$", "sequence": null }, { "id": "potential-peptide", "name": "Potential peptide", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01189", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01189/entry", "note": "mature peptide 105-134 of Pro-opiomelanocortin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "EDVSAGEDCGPLPEGGPEPRSDGAKPGPRE" }, { "id": "pr1-leukemia-peptide-vaccine", "name": "pr1 Leukemia Peptide Vaccine", "synonyms": [ "Pr1 vac", "Proteinase 3 pr1 peptide" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297811", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297811/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Vaccine component", "helm": null, "sequence": null }, { "id": "pramlintide", "name": "Pramlintide", "synonyms": [ "AC-0137", "AC-137", "AC0-137", "AC0137", "AC137", "Pramlintida", "Pramlintide acetate anhydrous", "Symlin", "Symlinpen", "Tripro-amylin", "Tripro-amylin acetate", "Tripro-amylin acetate hydrate" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2005, "sources": [ { "type": "chembl", "id": "CHEMBL2103758", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2103758/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL3833353", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3833353/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "pramlintide", "gpMatch": "name", "innStem": "-tide", "usanYear": 1996, "chemblType": "Protein", "helm": "PEPTIDE1{K.C.N.T.A.T.C.A.T.Q.R.L.A.N.F.L.V.H.S.S.N.N.F.G.P.I.L.P.P.T.N.V.G.S.N.T.Y.[am]}$PEPTIDE1,PEPTIDE1,7:R3-2:R3$$$", "sequence": null }, { "id": "prazarelix", "name": "Prazarelix", "synonyms": [ "Azaline b", "RWJ 47428", "RWJ-47428", "RWJ47428" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL409018", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL409018/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL2105773", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2105773/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": null, "gpMatch": null, "innStem": "-relix", "usanYear": 1998, "chemblType": "Protein", "helm": "PEPTIDE1{[ac].[dNal].[dPhe(4-Cl)].[d3-Pal].S.[X569].[X570].L.[X4].P.[dA].[am]}$$$$", "sequence": null }, { "id": "preptin", "name": "Preptin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01344", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01344/entry", "note": "mature peptide 93-126 of Insulin-like growth factor 2" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRL" }, { "id": "proadrenomedullin-9-20-terminal-peptide", "name": "Proadrenomedullin 9-20 terminal peptide", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P35318", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P35318/entry", "note": "mature peptide 30-41 of Pro-adrenomedullin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "FRKKWNKWALSR" }, { "id": "proadrenomedullin-n-20-terminal-peptide", "name": "Proadrenomedullin N-20 terminal peptide", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P35318", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P35318/entry", "note": "mature peptide 22-41 of Pro-adrenomedullin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "ARLDVASEFRKKWNKWALSR" }, { "id": "probnp-3-108", "name": "proBNP(3-108)", "synonyms": [], "moleculeClass": "protein", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P16860", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P16860/entry", "note": "mature peptide 29-134 of Natriuretic peptides B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "LGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH" }, { "id": "processed-osteocrin", "name": "Processed Osteocrin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P61366", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P61366/entry", "note": "mature peptide 83-132 of Osteocrin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "SFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSR" }, { "id": "prolactin-releasing-peptide-prrp20", "name": "Prolactin-releasing peptide PrRP20", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P81277", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P81277/entry", "note": "mature peptide 34-53 of Prolactin-releasing peptide" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "TPDINPAWYASRGIRPVGRF" }, { "id": "prolactin-releasing-peptide-prrp31", "name": "Prolactin-releasing peptide PrRP31", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P81277", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P81277/entry", "note": "mature peptide 23-53 of Prolactin-releasing peptide" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "SRTHRHSMEIRTPDINPAWYASRGIRPVGRF" }, { "id": "prostamax", "name": "Prostamax", "synonyms": [ "KEDP tetrapeptide", "Prostagen", "Prostate peptide bioregulator" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 19830585", "url": "https://pubmed.ncbi.nlm.nih.gov/19830585/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "prostamax", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "protirelin", "name": "Protirelin", "synonyms": [ "5-oxo-pro-his-pro-nh2", "A-38579", "ABBOTT-38579", "Lopremone", "NSC-760113", "Protirelin, synthetic", "Protirelina", "Protireline", "Relefact trh", "SYNTHETIC TRH", "Thypinone", "Thyrel trh", "Thyroid releasing hormone", "Thyroliberin", "Thyrotropin releasing hormone", "Thyrotropin-releasing factor", "Thyrotropin-releasing hormone", "Trh", "Trh-cambridge" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1976, "sources": [ { "type": "chembl", "id": "CHEMBL1472", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1472/", "read": "2026-10-02" }, { "type": "uniprot", "id": "P20396", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P20396/entry", "note": "mature peptide 84-86 of Pro-thyrotropin-releasing hormone, 6 copies" } ], "gpEntry": "protirelin", "gpMatch": "name", "innStem": "-relin", "usanYear": 1974, "chemblType": "Protein", "helm": "PEPTIDE1{[Glp].H.P.[am]}$$$$", "sequence": null }, { "id": "proxenin", "name": "Proxenin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P53621", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P53621/entry", "note": "mature peptide 1-35 of Coatomer subunit alpha" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQL" }, { "id": "pt-141", "name": "PT-141", "synonyms": [ "Bremelanotida", "PT 141", "PT-141", "PT-141 FREE BASE", "Vyleesi", "Vyleesi (autoinjector)" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2019, "sources": [ { "type": "chembl", "id": "CHEMBL2070241", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2070241/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL4297533", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297533/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "pt-141", "gpMatch": "alias", "innStem": "-tide", "usanYear": 2005, "chemblType": "Protein", "helm": "PEPTIDE1{H.[dF].R.W.K}|PEPTIDE2{[ac].[Nle].D}$PEPTIDE2,PEPTIDE1,3:R2-1:R1|PEPTIDE2,PEPTIDE1,3:R3-5:R3$$$", "sequence": null }, { "id": "ptd-dbm", "name": "PTD-DBM", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 176453931", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/176453931", "read": "2026-10-02", "note": "PubChem title: Ptd-dbm" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "pthrp-1-36", "name": "PTHrP[1-36]", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P12272", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P12272/entry", "note": "mature peptide 37-72 of Parathyroid hormone-related protein" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEI" }, { "id": "pthrp-38-94", "name": "PTHrP[38-94]", "synonyms": [], "moleculeClass": "protein", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P12272", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P12272/entry", "note": "mature peptide 74-130 of Parathyroid hormone-related protein" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "ATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKP" }, { "id": "pyy", "name": "Peptide YY", "synonyms": [ "Gt-001", "Human peptide yy (3-36)", "Peptide yy (3-36)", "Pyy 3-36", "Pyy(3-36)", "Pyy3-36" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297971", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297971/", "read": "2026-10-02" }, { "type": "uniprot", "id": "P10082", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P10082/entry", "note": "mature peptide 29-64 of Peptide YY" } ], "gpEntry": "pyy", "gpMatch": "alias", "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "qrf-amide", "name": "QRF-amide", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P83859", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P83859/entry", "note": "mature peptide 91-133 of Orexigenic neuropeptide QRFP" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "QDEGSEATGFLPAAGEKTSGPLGNLAEELNGYSRKKGGFSFRF" }, { "id": "quazomotide", "name": "Quazomotide", "synonyms": [ "Quazomotida", "Wt-1 427 long", "Wt1-427 long" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314767", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314767/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "ramorelix", "name": "Ramorelix", "synonyms": [], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3989808", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3989808/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-relix", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "ravatirelin", "name": "Ravatirelin", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": -1.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108306", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108306/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-relin", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "recanaclotide", "name": "Recanaclotide", "synonyms": [ "IW-9179", "Recanaclotida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3707244", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3707244/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2015, "chemblType": "Protein", "helm": "PEPTIDE1{A.C.T.G.[dC]}|PEPTIDE2{C.C.[X134].L.C.C.N.P}$PEPTIDE2,PEPTIDE2,6:R3-1:R3|PEPTIDE2,PEPTIDE1,5:R3-5:R3|PEPTIDE2,PEPTIDE1,2:R3-2:R3$$$", "sequence": null }, { "id": "redasemtide", "name": "Redasemtide", "synonyms": [ "S-005151" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068588", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068588/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "relamorelin", "name": "Relamorelin", "synonyms": [ "BIM-28131", "BIM28131", "Relamorelina", "Relamoreline" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297525", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297525/", "read": "2026-10-02" } ], "gpEntry": "relamorelin", "gpMatch": "name", "innStem": "-relin", "usanYear": null, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "relaxin-3-a-chain", "name": "Relaxin-3 A chain", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q8WXF3", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q8WXF3/entry", "note": "mature peptide 119-142 of Relaxin-3" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "DVLAGLSSSCCKWGCSKSEISSLC" }, { "id": "relaxin-3-b-chain", "name": "Relaxin-3 B chain", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q8WXF3", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q8WXF3/entry", "note": "mature peptide 26-52 of Relaxin-3" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "RAAPYGVRLCGREFIRAVIFTCGGSRW" }, { "id": "relaxin-a-chain-rln1", "name": "Relaxin A chain (RLN1)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P04808", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P04808/entry", "note": "mature peptide 163-185 of Prorelaxin H1" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "PYVALFEKCCLIGCTKRSLAKYC" }, { "id": "relaxin-a-chain-rln2", "name": "Relaxin A chain (RLN2)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P04090", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P04090/entry", "note": "mature peptide 162-185 of Prorelaxin H2" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "QLYSALANKCCHVGCTKRSLARFC" }, { "id": "relaxin-b-chain-rln1", "name": "Relaxin B chain (RLN1)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P04808", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P04808/entry", "note": "mature peptide 23-53 of Prorelaxin H1" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "VAAKWKDDVIKLCGRELVRAQIAICGMSTWS" }, { "id": "relaxin-b-chain-rln2", "name": "Relaxin B chain (RLN2)", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P04090", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P04090/entry", "note": "mature peptide 25-53 of Prorelaxin H2" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "DSWMEEVIKLCGRELVRAQIAICGMSTWS" }, { "id": "relugolix", "name": "Relugolix", "synonyms": [ "Orgovyx", "Relumina", "TAK-385" ], "moleculeClass": "small-molecule", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 32469183", "url": "https://pubmed.ncbi.nlm.nih.gov/32469183/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "relugolix", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "retatrutide", "name": "Retatrutide", "synonyms": [ "LY-3437943", "LY3437943" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5095485", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5095485/", "read": "2026-10-02" } ], "gpEntry": "retatrutide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2022, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "rezafungin", "name": "Rezafungin", "synonyms": [ "Rezzayo" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2023, "sources": [ { "type": "openfda", "id": "NDA217417", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=217417", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "rezafungin", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "rimorphin", "name": "Rimorphin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01213", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01213/entry", "note": "mature peptide 226-238 of Proenkephalin-B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "YGGFLRRQFKVVT" }, { "id": "rimtoregtide", "name": "Rimtoregtide", "synonyms": [ "Rimtoregtida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5095151", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5095151/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "rismorelin", "name": "Rismorelin", "synonyms": [ "Rismorelina", "Rismoreline" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108294", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108294/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-relin", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "rismorelin-porcine", "name": "Rismorelin Porcine", "synonyms": [ "Rismorelin" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": -1.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108761", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108761/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-relin", "usanYear": 1995, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "rolipoltide", "name": "Rolipoltide", "synonyms": [ "Rolipoltida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108284", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108284/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "romiplostim", "name": "Romiplostim", "synonyms": [ "AMG 531", "Nplate", "TPO mimetic peptibody" ], "moleculeClass": "protein", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 18242413", "url": "https://pubmed.ncbi.nlm.nih.gov/18242413/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "romiplostim", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "romurtide", "name": "Romurtide", "synonyms": [ "Nopia", "Romurtida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL1908331", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1908331/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "rotigaptide", "name": "Rotigaptide", "synonyms": [ "GAP (WYETH)", "Rotigaptida", "ZP-123", "ZP-123 (ZEALAND)" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL450656", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL450656/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2005, "chemblType": "Protein", "helm": "PEPTIDE1{[ac].[dY].[dP].[dHyp].G.[dA].G.[am]}$$$$", "sequence": null }, { "id": "rovatirelin", "name": "Rovatirelin", "synonyms": [ "KPS-0373", "Kps-0373", "Rovatirelina", "Rovatireline", "S-0373" ], "moleculeClass": "peptidomimetic", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297622", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297622/", "read": "2026-10-02" } ], "gpEntry": "rovatirelin", "gpMatch": "name", "innStem": "-relin", "usanYear": null, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "rugecitide", "name": "Rugecitide", "synonyms": [ "LY-3461767", "LY3461767", "Ly3461767" ], "moleculeClass": "peptide", "status": "phase-1", "maxPhase": 1.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068616", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068616/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2024, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "rusalatide", "name": "Rusalatide", "synonyms": [ "Chrysalin", "Rusalatida", "Rusalatide acetate (3:2)", "TP 508", "TP-508", "TP-508 ACETATE", "TRAP-508", "TRAP-508 ACETATE", "Tp508" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2111105", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2111105/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL2107369", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2107369/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": null, "gpMatch": null, "innStem": "-sal-; -tide", "usanYear": 2005, "chemblType": "Protein", "helm": "PEPTIDE1{A.G.Y.K.P.D.E.G.K.R.G.D.A.C.E.G.D.S.G.G.P.F.V.[am]}$$$$", "sequence": null }, { "id": "rusfertide", "name": "Rusfertide", "synonyms": [ "PTG-300", "PTG-300 ACETATE", "PTG-300FB", "PTG300 ACETATE", "Ptg-300" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4650270", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4650270/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL4650507", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4650507/", "read": "2026-10-02", "note": "separate ChEMBL record of the same molecule" } ], "gpEntry": "rusfertide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2021, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "ruxotemitide", "name": "Ruxotemitide", "synonyms": [ "Kkwwkkw-.beta.-phenyl-fk-nh2", "Kkwwkkwdipk-nh2", "Ltx 315", "Ltx-315", "Oncopore", "Ruxotemitida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297628", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297628/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "salusin-alpha", "name": "Salusin-alpha", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q8N2E6", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q8N2E6/entry", "note": "mature peptide 214-241 of Prosalusin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "SGALPPAPAAPRPALRAQRAGPAGPGAK" }, { "id": "salusin-beta", "name": "Salusin-beta", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q8N2E6", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q8N2E6/entry", "note": "mature peptide 192-211 of Prosalusin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "AIFIFIRWLLKLGHHGRAPP" }, { "id": "satoreotide-tetraxetan", "name": "Satoreotide Tetraxetan", "synonyms": [ "DOTA-JR-11", "Dota satoreotide", "Satoreotida tetraxetan", "Satoreotide dota" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297531", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297531/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide; -xetan", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "satoreotide-trizoxetan", "name": "Satoreotide Trizoxetan", "synonyms": [ "JR-11-NODAGA", "NODAGA-JR11", "OPS-202", "Ops202", "Satoreotida trizoxetan" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297532", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297532/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide; -xetan", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "secretin", "name": "Secretin", "synonyms": [ "Chirhostim" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2004, "sources": [ { "type": "openfda", "id": "NDA021256", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=021256", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" }, { "type": "uniprot", "id": "P09683", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P09683/entry", "note": "mature peptide 28-54 of Secretin" } ], "gpEntry": "secretin", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "HSDGTFTSELSRLREGARLQRLLQGLV" }, { "id": "seglitide", "name": "Seglitide", "synonyms": [ "L-363586", "MK-678", "Seglitida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL311695", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL311695/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL2103887", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2103887/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 1987, "chemblType": "Protein", "helm": "PEPTIDE1{[meA].Y.[dW].K.V.F}$PEPTIDE1,PEPTIDE1,6:R2-1:R1$$$", "sequence": null }, { "id": "selank", "name": "Selank", "synonyms": [ "TP-7", "threonyl-lysyl-prolyl-arginyl-prolyl-glycyl-proline" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 18454096", "url": "https://pubmed.ncbi.nlm.nih.gov/18454096/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "selank", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "selcopintide", "name": "Selcopintide", "synonyms": [ "Selcopintida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5095083", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5095083/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "selepressin", "name": "Selepressin", "synonyms": [ "FE 202158", "FE-202158", "FE202158", "Fe-202158", "Selepresina", "Selepressine" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL1817709", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1817709/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-pressin", "usanYear": 2014, "chemblType": "Protein", "helm": "PEPTIDE1{[am]}|PEPTIDE2{C.F.I.[Aad].N.C.P.[X1968].G.[am]}$PEPTIDE2,PEPTIDE2,6:R3-1:R3|PEPTIDE2,PEPTIDE1,4:R3-1:R1$$$", "sequence": null }, { "id": "semaglutide", "name": "Semaglutide", "synonyms": [ "NN-9535", "NN9535", "NNC 0113-0217", "NNC-0113-0217", "Nn9535", "Ozempic", "Rybelsus", "Semaglutida", "Semaglutide component of cagrisema", "Semaglutide component of nn1535 icosema", "Semaglutide component of nn1535 laisema", "Wegovy" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2017, "sources": [ { "type": "chembl", "id": "CHEMBL2108724", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108724/", "read": "2026-10-02" } ], "gpEntry": "semaglutide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2010, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "semax", "name": "Semax", "synonyms": [ "ACTH(4-7)PGP", "methionyl-glutamyl-histidyl-phenylalanyl-prolyl-glycyl-proline" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 16635254", "url": "https://pubmed.ncbi.nlm.nih.gov/16635254/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "semax", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "semparatide", "name": "Semparatide", "synonyms": [ "RO 106-6271/297", "RO 70-0001/001", "RO-106-6271/297", "RO-1066271297", "RO-70-0001/001", "RO-700001001", "RS-66271", "RS-66271-297", "Semparatida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2103974", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2103974/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL2108879", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108879/", "read": "2026-10-02", "note": "separate ChEMBL record of the same molecule" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{A.V.S.E.H.Q.L.L.H.D.K.G.K.S.I.Q.D.L.R.R.R.E.L.L.E.K.L.L.E.K.L.H.T.A.[am]}$$$$", "sequence": null }, { "id": "seractide", "name": "Seractide", "synonyms": [], "moleculeClass": "peptide", "status": "withdrawn", "maxPhase": 4.0, "firstApproval": 1978, "sources": [ { "type": "chembl", "id": "CHEMBL1201489", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1201489/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 1974, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "sermorelin", "name": "Sermorelin", "synonyms": [ "Geref", "Groliberin", "Sermorelina", "Sermoreline" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1990, "sources": [ { "type": "chembl", "id": "CHEMBL1201490", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1201490/", "read": "2026-10-02" } ], "gpEntry": "sermorelin", "gpMatch": "name", "innStem": "-relin", "usanYear": 1989, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "setmelanotide", "name": "Setmelanotide", "synonyms": [ "BIM-22493", "Imcivree", "RM-493", "RM-493 ACETATE", "Setmelanotida" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2020, "sources": [ { "type": "chembl", "id": "CHEMBL3301624", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3301624/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL4650273", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4650273/", "read": "2026-10-02", "note": "salt form, folded into this row" }, { "type": "chembl", "id": "CHEMBL4594386", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4594386/", "read": "2026-10-02", "note": "separate ChEMBL record of the same molecule" } ], "gpEntry": "setmelanotide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2014, "chemblType": "Protein", "helm": "PEPTIDE1{[ac].R.C.[dA].H.[dF].R.W.C.[am]}$PEPTIDE1,PEPTIDE1,9:R3-3:R3$$$", "sequence": null }, { "id": "shlp2", "name": "SHLP2", "synonyms": [ "MT-RNR2-derived SHLP2", "Small humanin-like peptide 2" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 27070352", "url": "https://pubmed.ncbi.nlm.nih.gov/27070352/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "shlp2", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "shlp6", "name": "SHLP6", "synonyms": [ "MT-RNR2-derived SHLP6", "Small humanin-like peptide 6" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 27070352", "url": "https://pubmed.ncbi.nlm.nih.gov/27070352/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "shlp6", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "sinapultide", "name": "Sinapultide", "synonyms": [ "ATI 01", "ATI-01", "KL-4", "KL4", "Kl4 peptide", "PEPTIDE KL-4", "PEPTIDE KL4", "RWJ-45652", "Sinapultida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2103901", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2103901/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 1997, "chemblType": "Protein", "helm": "PEPTIDE1{K.L.L.L.L.K.L.L.L.L.K.L.L.L.L.K.L.L.L.L.K}$$$$", "sequence": null }, { "id": "slu-pp-332", "name": "SLU-PP-332", "synonyms": [], "moleculeClass": "small-molecule", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 5338394", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/5338394", "read": "2026-10-02", "note": "PubChem title: Slu-PP-332" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "solnatide", "name": "Solnatide", "synonyms": [ "AP-301", "AP301", "Ap-301", "Ap301", "Solnatida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297885", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297885/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "somapacitan", "name": "Somapacitan", "synonyms": [ "NN8640", "Sogroya", "somapacitan-beco" ], "moleculeClass": "protein", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 36062966", "url": "https://pubmed.ncbi.nlm.nih.gov/36062966/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "somapacitan", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "somatorelin", "name": "Somatorelin", "synonyms": [ "Esfarase", "Ghrh ferring", "Ghrh(1-44) amide", "Ghrh(1-44)nh2", "Grf 1-44", "Somatocrinin", "Somatoliberin", "Somatoliberin (human)", "Somatoliberin, human", "Somatorelina", "Somatoreline", "Sr 95228", "Sr-95228" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108862", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108862/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-relin; som-", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "somatostatin", "name": "Somatostatin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P61278", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P61278/entry", "note": "mature peptide 103-116 of Somatostatin" } ], "gpEntry": "somatostatin", "gpMatch": "sequence", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "AGCKNFFWKTFTSC" }, { "id": "somatostatin-28", "name": "Somatostatin-28", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P61278", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P61278/entry", "note": "mature peptide 89-116 of Somatostatin" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "SANSNPAMAPRERKAGCKNFFWKTFTSC" }, { "id": "somatrogon", "name": "Somatrogon", "synonyms": [ "CTP-modified hGH", "MOD-4023", "Ngenla", "OPK-88003", "somatrogon-ghla" ], "moleculeClass": "protein", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 35405011", "url": "https://pubmed.ncbi.nlm.nih.gov/35405011/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "somatrogon", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "somatropin", "name": "Somatropin (HGH)", "synonyms": [ "Ansomone", "Genotropin", "HGH", "HGH 191AA", "Humatrope", "Hygetropin", "Jintropin", "Kigtropin", "Norditropin", "Omnitrope", "Saizen", "Serostim", "Zomacton", "human growth hormone", "rhGH" ], "moleculeClass": "protein", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 21602453", "url": "https://pubmed.ncbi.nlm.nih.gov/21602453/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "somatropin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "sonefpeglutide", "name": "Sonefpeglutide", "synonyms": [ "Sonefpeglutida" ], "moleculeClass": "peptide-conjugate", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068175", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068175/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-peg-; -tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "sovateltide", "name": "Sovateltide", "synonyms": [ "IRL-1620", "Irl-1620", "PMZ-1620", "SPI 1620", "SPI-1620", "Sovateltide", "Spi 1620", "Spi-1620" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3188091", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3188091/", "read": "2026-10-02" } ], "gpEntry": "sovateltide", "gpMatch": "alias", "innStem": "-tide", "usanYear": 2020, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "spexin-1", "name": "Spexin-1", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q9BT56", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9BT56/entry", "note": "mature peptide 36-49 of Spexin, 2 copies" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "NWTPQAMLYLKGAQ" }, { "id": "spexin-2", "name": "Spexin-2", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q9BT56", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q9BT56/entry", "note": "mature peptide 53-70 of Spexin, 2 copies" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "FISDQSRRKDLSDRPLPE" }, { "id": "ss-31", "name": "SS-31 (Elamipretide)", "synonyms": [ "Bendavia", "Elamipretida", "MTP 131", "MTP-131", "MTP131", "Nh2-d-arg-dmt-lys-phe-nh2", "Ocuvia", "RX 31", "RX-31", "RX31", "SS 31", "SS-31", "SS31", "Szeto-schiller peptide" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3833370", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3833370/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL4298161", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4298161/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "ss-31", "gpMatch": "alias", "innStem": "-tide", "usanYear": 2016, "chemblType": "Protein", "helm": "PEPTIDE1{[dR].[X138].K.F.[am]}$$$$", "sequence": null }, { "id": "substance-p", "name": "Substance P", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P20366", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P20366/entry", "note": "mature peptide 58-68 of Protachykinin-1" } ], "gpEntry": "substance-p", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "RPKPQQFFGLM" }, { "id": "sucantomotide", "name": "Sucantomotide", "synonyms": [ "Sucantomotida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314883", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314883/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "sudocetaxel-zendusortide", "name": "Sudocetaxel Zendusortide", "synonyms": [ "Sudocetaxel zendusortida", "TH-1902", "TH1902", "Th19p01-docetaxel" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5095153", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5095153/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-taxel; -tide", "usanYear": 2023, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "sulglicotide", "name": "Sulglicotide", "synonyms": [ "Demucine", "Gliptide", "Sulglicotida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108085", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108085/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "survodutide", "name": "Survodutide", "synonyms": [ "BI 456906", "BI-456906", "BI456906", "Survodutida" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314776", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314776/", "read": "2026-10-02" } ], "gpEntry": "survodutide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2024, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "svn53-67-m57-klh-peptide-vaccine", "name": "Svn53-67/m57-klh Peptide Vaccine", "synonyms": [ "Survaxm" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4650424", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4650424/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Vaccine component", "helm": null, "sequence": null }, { "id": "syn-ake", "name": "Syn-Ake", "synonyms": [ "Dipeptide Diaminobutyroyl Benzylamide Diacetate", "β-Ala-Pro-Dab-NHBn·2AcOH" ], "moleculeClass": "peptidomimetic", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 37349941", "url": "https://pubmed.ncbi.nlm.nih.gov/37349941/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "syn-ake", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "synenkephalin", "name": "Synenkephalin", "synonyms": [], "moleculeClass": "protein", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01210", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01210/entry", "note": "mature peptide 25-97 of Proenkephalin-A" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "ECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLA" }, { "id": "synthetic-peptide-analogue-of-gnrf-conjugated-to-diptheria-toxoid", "name": "Synthetic Peptide Analogue Of Gnrf Conjugated To Diptheria Toxoid", "synonyms": [ "Improvac", "Improvest" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": -1.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5315094", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5315094/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Unknown", "helm": null, "sequence": null }, { "id": "tabilautide", "name": "Tabilautide", "synonyms": [ "Tabilautida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3989637", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3989637/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "tabimorelin", "name": "Tabimorelin", "synonyms": [ "NN-703", "NNC-26-0703", "Nn703", "Tabimorelina", "Tabimoreline" ], "moleculeClass": "small-molecule", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL281764", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL281764/", "read": "2026-10-02" } ], "gpEntry": "tabimorelin", "gpMatch": "name", "innStem": "-relin", "usanYear": null, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "talfirastide", "name": "Talfirastide", "synonyms": [ "5-ile-angiotensin-(1-7)", "A(1-7)", "Ang-(1-7)", "Angiotensin (1-7)", "Angiotensin 1-7", "Angiotensin fragment 1-7", "Angiotensin peptide (1-7)", "Angiotensin-(1-7)", "Asp-arg-val-tyr-ile-his-pro", "Bf-angiotensin 1-7", "ETRX-101", "Human angiotensin ii (1-7)", "Marstem", "Sh-heptapeptide-13", "TXA-127", "TXA127", "Talfirastida", "Txa127", "USB-003", "USB003" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3545347", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3545347/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2024, "chemblType": "Protein", "helm": "PEPTIDE1{D.R.V.Y.I.H.P}$$$$", "sequence": null }, { "id": "talogreptide-mesaroxetan", "name": "Talogreptide Mesaroxetan", "synonyms": [ "SAR-BBN FREE BASE NON-LABELED", "Talogreptida mesaroxetan" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068177", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068177/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide; -xetan", "usanYear": null, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "taltirelin", "name": "Taltirelin", "synonyms": [ "TA-0910", "Taltirelina", "Taltireline" ], "moleculeClass": "peptidomimetic", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2107016", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2107016/", "read": "2026-10-02" } ], "gpEntry": "taltirelin", "gpMatch": "name", "innStem": "-relin", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{[X272].H.P.[am]}$$$$", "sequence": null }, { "id": "taspoglutide", "name": "Taspoglutide", "synonyms": [ "BIM-51077", "BIM51077", "R-1583", "R1583", "RO-5073031", "RO5073031", "Taspoglutida" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2107860", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2107860/", "read": "2026-10-02" } ], "gpEntry": "taspoglutide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2008, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "tb-500", "name": "TB-500", "synonyms": [ "TMSB4X peptide", "Thymosin beta-4 fragment", "Tβ4 fragment" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 20536472", "url": "https://pubmed.ncbi.nlm.nih.gov/20536472/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "tb-500", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "tecemotide", "name": "Tecemotide", "synonyms": [ "BLP-25", "BLP25", "BP-1-148", "Blp 25", "Blp-25 lipopeptide", "Blp25 lipopeptide", "EMD 531444", "Emepepimut-s", "LIPOPEPTIDE BLP-25", "Stimuvax", "Tecemotida" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3039544", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3039544/", "read": "2026-10-02" } ], "gpEntry": "tecemotide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2013, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "technetium-99mtc-apcitide", "name": "Technetium (99mtc) Apcitide", "synonyms": [ "(99MTC)-P246", "99MTC-P246", "Acutect", "Technetium tc 99m apcitide", "Technetium tc-99m apcitide", "Tecnecio (99mtc) apcitida", "[99MTC]-P246" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1998, "sources": [ { "type": "chembl", "id": "CHEMBL1201524", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1201524/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 1997, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "technetium-99mtc-etarfolatide", "name": "Technetium (99mtc) Etarfolatide", "synonyms": [ "Folatescan", "TC-99M EC-20", "TC99M-EC20", "Technetium tc 99m etarfolatide", "Technetium tc 99m pterotetramide", "Technetium tc-99m ec20", "Technetium tc-99m etarfolatide", "Technetium tc-99m pterotetramide", "Tecnecio (99mtc) etarfolatida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3707391", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3707391/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "technetium-mertiatide", "name": "Technetium Mertiatide", "synonyms": [ "TC-MAG3", "TECHNETIUM TC 99M MERTIATIDE", "Technescan mag3", "Technetium (99mtc) mertiatide", "Technetium tc 99m mertiatide", "Technetium tc 99m mertiatide kit", "Technetium tc-99m mertiatide", "Technetium tc-99m mertiatide kit" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1990, "sources": [ { "type": "chembl", "id": "CHEMBL2111131", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2111131/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL2107488", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2107488/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 1990, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "technetium-tc-99m-depreotide", "name": "Technetium Tc 99m Depreotide", "synonyms": [ "Neo tect kit", "Technetium (99mtc) depreotide" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1999, "sources": [ { "type": "chembl", "id": "CHEMBL1201413", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1201413/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "technetium-tc-99m-tiatide", "name": "Technetium Tc 99m Tiatide", "synonyms": [ "99mtc-mag3", "Technetium tc 99m mertiatide anion", "Technetium tc-99m tiatide (anion)", "Technetium tc-99m tiatide anion" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": -1.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108142", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108142/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "teduglutide", "name": "Teduglutide", "synonyms": [ "ALX 0600", "ALX-0600", "Gattex", "Gattex kit", "Revestive", "Teduglutida", "Teduglutide (rdna origin)", "Teduglutide recombinant" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2012, "sources": [ { "type": "chembl", "id": "CHEMBL2104987", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2104987/", "read": "2026-10-02" } ], "gpEntry": "teduglutide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2000, "chemblType": "Protein", "helm": "PEPTIDE1{H.G.D.G.S.F.S.D.E.M.N.T.I.L.D.N.L.A.A.R.D.F.I.N.W.L.I.Q.T.K.I.T.D}$$$$", "sequence": null }, { "id": "teicoplanin", "name": "Teicoplanin", "synonyms": [ "MDL 507", "MDL-507", "NSC-759183", "Tagocid", "Targocid", "Targosid", "Teichomycin a2", "Teicoplanin a2", "Teicoplanina", "Teicoplanine", "Teikoplanin", "Ticocin" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4297166", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297166/", "read": "2026-10-02" } ], "gpEntry": "teicoplanin", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": "Unknown", "helm": null, "sequence": null }, { "id": "telavancin", "name": "Telavancin", "synonyms": [ "Vibativ" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2009, "sources": [ { "type": "openfda", "id": "NDA022110", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=022110", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "telavancin", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "temurtide", "name": "Temurtide", "synonyms": [ "RS-37449", "Temurtida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3989635", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3989635/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 1989, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "teprotide", "name": "Teprotide", "synonyms": [ "SO 20881", "SO-20881", "SQ 20881", "SQ-20881", "Tepromide", "Teprotida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL408983", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL408983/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 1976, "chemblType": "Protein", "helm": "PEPTIDE1{[Glp].W.P.R.P.Q.I.P.P}$$$$", "sequence": null }, { "id": "teriparatide", "name": "Teriparatide", "synonyms": [ "(1-34)-human parathyroid hormone", "1-34-human pth", "Ak-159", "Ak159", "Bonsity", "Forsteo", "Forteo", "HPTH 1-34", "HPTH 1-34 (ACETATE SALT)", "HPTH-1-34", "Human parathyroid hormone 1-34", "Kauliv", "LY 333334", "LY-333334", "LY333334", "Livogiva", "Movymia", "Parathar", "Pth (1-34)", "Qutavina", "Sondelbay", "Teriparatida", "Teriparatide rdna", "Teriparatide recombinant human", "Teriparatide sun", "Terrosa", "ZT-034" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1987, "sources": [ { "type": "chembl", "id": "CHEMBL1201549", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1201549/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL525610", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL525610/", "read": "2026-10-02", "note": "separate ChEMBL record of the same molecule" } ], "gpEntry": "teriparatide", "gpMatch": "name", "innStem": "-tide", "usanYear": 1986, "chemblType": "Protein", "helm": "PEPTIDE1{S.V.S.E.I.Q.L.M.H.N.L.G.K.H.L.N.S.M.E.R.V.E.W.L.R.K.K.L.Q.D.V.H.N.F}$$$$", "sequence": null }, { "id": "terlipressin", "name": "Terlipressin", "synonyms": [ "Glycylpressin", "Glypressin", "Terlipresina", "Terlipressine", "Terlivaz", "Variquel" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2022, "sources": [ { "type": "chembl", "id": "CHEMBL2135460", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2135460/", "read": "2026-10-02" } ], "gpEntry": "terlipressin", "gpMatch": "name", "innStem": "-pressin", "usanYear": 2006, "chemblType": "Protein", "helm": "PEPTIDE1{G.G.G.C.Y.F.Q.N.C.P.K.G.[am]}$PEPTIDE1,PEPTIDE1,9:R3-4:R3$$$", "sequence": null }, { "id": "tertomotide", "name": "Tertomotide", "synonyms": [ "GV-1001", "GV1001", "Gv1001", "Htert (534-549)", "Tertomotida" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108308", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108308/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "tesamorelin", "name": "Tesamorelin", "synonyms": [ "Egrifta", "TH-9507", "TH-9507 ACETATE", "TH9507", "Tesamorelina", "Tesamoreline" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2010, "sources": [ { "type": "chembl", "id": "CHEMBL1237026", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1237026/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL2111290", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2111290/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "tesamorelin", "gpMatch": "name", "innStem": "-relin", "usanYear": 2006, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "tesofensine", "name": "Tesofensine", "synonyms": [ "NS2330" ], "moleculeClass": "small-molecule", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 17324246", "url": "https://pubmed.ncbi.nlm.nih.gov/17324246/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "tesofensine", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "testagen", "name": "Testagen", "synonyms": [ "KEDG tetrapeptide (Khavinson testis)", "Testis peptide bioregulator" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 19830585", "url": "https://pubmed.ncbi.nlm.nih.gov/19830585/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "testagen", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "tetracosactide", "name": "Tetracosactide", "synonyms": [ "Cortrosyn", "HOE-254", "Tricosactida" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1970, "sources": [ { "type": "chembl", "id": "CHEMBL2103923", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2103923/", "read": "2026-10-02" }, { "type": "openfda", "id": "NDA016750", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=016750", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "tetracosactide", "gpMatch": "sequence", "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{S.Y.S.M.E.H.F.R.W.G.K.P.V.G.K.K.R.R.P.V.K.V.Y.[am]}$$$$", "sequence": null }, { "id": "tetrapeptide-21", "name": "Tetrapeptide-21", "synonyms": [ "GEKG peptide" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 42630677", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/42630677", "read": "2026-10-02", "note": "PubChem title: GEKG peptide" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "teverelix", "name": "Teverelix", "synonyms": [ "Antarelix", "D-23234", "EP-24332" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2103945", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2103945/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-relix", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{[ac].[dNal].[Phe(4-Cl)].[d3-Pal].S.[dY].[X1207].L.[X4].P.[dA].[am]}$$$$", "sequence": null }, { "id": "thymalin", "name": "Thymalin", "synonyms": [ "Calf-thymus polypeptide preparation", "Thymus peptide complex", "Timalin" ], "moleculeClass": "blend", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 36169363", "url": "https://pubmed.ncbi.nlm.nih.gov/36169363/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "thymalin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "thymogen", "name": "Thymogen", "synonyms": [ "Glu-Trp dipeptide", "Glutamyl-tryptophan", "Timogen" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 21957588", "url": "https://pubmed.ncbi.nlm.nih.gov/21957588/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "thymogen", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "thymopentin", "name": "Thymopentin", "synonyms": [ "TP-5", "TP5", "Thymopoietin 32-36", "Timunox" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 2185294", "url": "https://pubmed.ncbi.nlm.nih.gov/2185294/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "thymopentin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "thymosin-alpha-1", "name": "Thymosin α1", "synonyms": [ "TA1", "Tα1", "Zadaxin", "thymalfasin" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 39814420", "url": "https://pubmed.ncbi.nlm.nih.gov/39814420/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "thymosin-alpha-1", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "thymosin-beta-4", "name": "Thymosin β4", "synonyms": [ "RGN-259", "TB4", "TMSB4X", "Tβ4" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 12709011", "url": "https://pubmed.ncbi.nlm.nih.gov/12709011/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "thymosin-beta-4", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "thymulin", "name": "Thymulin", "synonyms": [ "FTS", "Facteur Thymique Sérique", "Serum Thymic Factor" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 6957870", "url": "https://pubmed.ncbi.nlm.nih.gov/6957870/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "thymulin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "tifuvirtide", "name": "Tifuvirtide", "synonyms": [ "T-1249", "T1249", "Tifuvirtida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108654", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108654/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide; -vir-", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "tigapotide", "name": "Tigapotide", "synonyms": [ "PCK-3145", "PCK3145", "TIGAPOTIDE TRIFLUTATE", "Tigapotida", "Tigapotide triflutate" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3040192", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3040192/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL2369994", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2369994/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2005, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "tiplimotide", "name": "Tiplimotide", "synonyms": [ "Nbi-5788", "Tiplimotida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108869", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108869/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "tirzepatide", "name": "Tirzepatide", "synonyms": [ "BG-121", "LY-3298176", "LY3298176", "Ly3298176", "Mounjaro", "Mounjaro (autoinjector)", "Tirzepatida", "Zepbound", "Zepbound (autoinjector)" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2022, "sources": [ { "type": "chembl", "id": "CHEMBL4297839", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4297839/", "read": "2026-10-02" } ], "gpEntry": "tirzepatide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2017, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "tosactide", "name": "Tosactide", "synonyms": [ ".alpha.1-28-corticotropin", ".alpha.1-28-corticotropin (human)", "Tosactida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2103904", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2103904/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{S.Y.S.M.E.H.F.R.W.G.K.P.V.G.K.K.R.R.P.V.K.V.Y.P.D.A.G.E}$$$$", "sequence": null }, { "id": "tozuleristide", "name": "Tozuleristide", "synonyms": [ "BLZ-100", "Tozuleristida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3990023", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3990023/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2017, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "trevogrumab", "name": "Trevogrumab", "synonyms": [ "REGN1033", "SAR391786" ], "moleculeClass": "antibody", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "clinicaltrials", "id": "NCT01507402", "url": "https://clinicaltrials.gov/study/NCT01507402", "read": "2026-10-02", "note": "trial registration cited on the encyclopedia entry" } ], "gpEntry": "trevogrumab", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "tridecactide", "name": "Tridecactide", "synonyms": [ ".alpha.-1-13-corticotropin, human", ".alpha.1-13-acth", "Alpha-1-13-corticotropin, human", "Tridecactida" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108340", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108340/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "trifluoroacetyl-tripeptide-2", "name": "Trifluoroacetyl Tripeptide-2", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 40785040", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/40785040", "read": "2026-10-02", "note": "PubChem title: Trifluoroacetyl tripeptide-2" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "triletide", "name": "Triletide", "synonyms": [ "Triletida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2105562", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2105562/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{[ac].[dF].[dF].[H_OMe]}$$$$", "sequence": null }, { "id": "tripeptide-10-citrulline", "name": "Tripeptide-10 Citrulline", "synonyms": [ "Decorinyl (trade name)", "Lys-Asp-Ile-Cit-NH2", "T10-C" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 18377618", "url": "https://pubmed.ncbi.nlm.nih.gov/18377618/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "tripeptide-10-citrulline", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "tripeptide-29", "name": "Tripeptide-29", "synonyms": [ "Glycyl-prolyl-hydroxyproline" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 11778669", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/11778669", "read": "2026-10-02", "note": "PubChem title: Glycyl-prolyl-hydroxyproline" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "triptorelin", "name": "Triptorelin", "synonyms": [ "AY-25650", "Arvekap", "CL 118,532", "CL-118532", "Decapeptyl", "Decapeptyl sr", "Gonapeptyl depot", "Ovugel", "Salvacyl", "Trelstar", "Triptodur", "Triptodur kit", "Triptorelin (as embonate)", "Triptorelina", "Triptoreline", "Tryptorelin", "WY-42462" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2000, "sources": [ { "type": "chembl", "id": "CHEMBL1201334", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1201334/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL1200554", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1200554/", "read": "2026-10-02", "note": "salt form, folded into this row" }, { "type": "chembl", "id": "CHEMBL5315073", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5315073/", "read": "2026-10-02", "note": "separate ChEMBL record of the same molecule" } ], "gpEntry": "triptorelin", "gpMatch": "name", "innStem": "-relin", "usanYear": 1987, "chemblType": "Protein", "helm": "PEPTIDE1{[Glp].H.W.S.Y.[dW].L.R.P.G.[am]}$$$$", "sequence": null }, { "id": "trofinetide", "name": "Trofinetide", "synonyms": [ "ACP-2566", "Daybue", "NNZ-2566", "Trofinetida" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2023, "sources": [ { "type": "chembl", "id": "CHEMBL197084", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL197084/", "read": "2026-10-02" } ], "gpEntry": "trofinetide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2022, "chemblType": "Small molecule", "helm": "PEPTIDE1{G.[X298].E}$$$$", "sequence": null }, { "id": "trolamine-polypeptide-oleate-condensate", "name": "Trolamine Polypeptide Oleate Condensate", "synonyms": [ "Cerumenex" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1958, "sources": [ { "type": "chembl", "id": "CHEMBL1201537", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1201537/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "tuberoinfundibular-peptide-of-39-residues", "name": "Tuberoinfundibular peptide of 39 residues", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q96A98", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q96A98/entry", "note": "mature peptide 62-100 of Tuberoinfundibular peptide of 39 residues" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP" }, { "id": "tyrothricin", "name": "Tyrothricin", "synonyms": [ "Bactratycin", "Coltirot", "Dermotricine", "Hydrotricine", "Martricin", "NSC-757363", "Solutricine", "Tirotricina", "Tyri 10", "Tyroderm", "Tyrosur", "Tyrothricine" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL577736", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL577736/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "ucasareotide-dasaroxetan", "name": "Ucasareotide Dasaroxetan", "synonyms": [ "Sartate", "Ucasareotida dasaroxetan" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314889", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314889/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide; -xetan", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "ularitide", "name": "Ularitide", "synonyms": [ "INN 00835", "INN-00835", "NEMIFITIDE DITRIFLUTATE", "Nemifitida", "Nemifitide bis(trifluoroacetate)", "Nemifitide ditriflutate", "Ularitida", "Urodilatin", "Urodilatin ularitide" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2103920", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2103920/", "read": "2026-10-02" }, { "type": "uniprot", "id": "P01160", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01160/entry", "note": "mature peptide 120-151 of Natriuretic peptides A" }, { "type": "chembl", "id": "CHEMBL2107761", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2107761/", "read": "2026-10-02", "note": "separate ChEMBL record of the same molecule" }, { "type": "chembl", "id": "CHEMBL2146091", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2146091/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "ularitide", "gpMatch": "name", "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{T.A.P.R.S.L.R.R.S.S.C.F.G.G.R.M.D.R.I.G.A.Q.S.G.L.G.C.N.S.F.R.Y}$PEPTIDE1,PEPTIDE1,27:R3-11:R3$$$", "sequence": null }, { "id": "ulimorelin", "name": "Ulimorelin", "synonyms": [ "TZP-101", "TZP-101 FREE BASE", "Ulimorelina", "Ulimoreline" ], "moleculeClass": "peptidomimetic", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL1963249", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1963249/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL1923502", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1923502/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "ulimorelin", "gpMatch": "name", "innStem": "-relin", "usanYear": 2009, "chemblType": "Small molecule", "helm": null, "sequence": null }, { "id": "urocortin", "name": "Urocortin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P55089", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P55089/entry", "note": "mature peptide 83-122 of Urocortin, 2 copies" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "DNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV" }, { "id": "urofollitropin", "name": "Urofollitropin", "synonyms": [ "Bravelle", "Fertinex", "Metrodin HP", "highly purified urinary FSH", "uFSH" ], "moleculeClass": "protein", "status": "approved", "maxPhase": 4.0, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 9402268", "url": "https://pubmed.ncbi.nlm.nih.gov/9402268/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "urofollitropin", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "uroguanylin", "name": "Uroguanylin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q16661", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q16661/entry", "note": "mature peptide 97-112 of Guanylate cyclase activator 2B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "NDDCELCVNVACTGCL" }, { "id": "urotensin-2", "name": "Urotensin-2", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "O95399", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/O95399/entry", "note": "mature peptide 114-124 of Urotensin-2" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "ETPDCFWKYCV" }, { "id": "urotensin-2b", "name": "Urotensin-2B", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "Q765I0", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/Q765I0/entry", "note": "mature peptide 112-119 of Urotensin-2B" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "ACFWKYCV" }, { "id": "utreglutide", "name": "Utreglutide", "synonyms": [ "Utreglutida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5095156", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5095156/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide; -treg-", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "vancomycin", "name": "Vancomycin", "synonyms": [ "Firvanq Kit", "Tyzavan" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2018, "sources": [ { "type": "openfda", "id": "NDA208910", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=208910", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "vancomycin", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "vanutide-cridificar", "name": "Vanutide Cridificar", "synonyms": [ "ACC-001", "Vanutida cridificar" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2108058", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2108058/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2008, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "vapreotide", "name": "Vapreotide", "synonyms": [ "BMY-41606", "BMY-41606 ACETATE", "DP-05-094", "Docrised", "Docrised (mexico)", "Octastatin", "Octastatin acetate", "RC-160", "RC-160 ACETATE", "Sanvar", "Vapreotida", "Vapreotide monoacetate" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3349523", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3349523/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL6067976", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6067976/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "vapreotide", "gpMatch": "name", "innStem": "-tide", "usanYear": 1989, "chemblType": "Protein", "helm": "PEPTIDE1{[dF].C.Y.[dW].K.V.C.W.[am]}$PEPTIDE1,PEPTIDE1,7:R3-2:R3$$$", "sequence": null }, { "id": "vasopressin", "name": "Vasopressin", "synonyms": [ "Arginine vasopressin", "Argipressin or lypressin", "Beta-hypophamine", "Inyectable de vasopresina", "Leiormone", "Solute injectable de vasopressine", "Vasophysin", "Vasopressin In Sodium Chloride 0.9%", "Vasopressin component of hbn-1", "Vasopressin injection", "Vasopressin, unspecified", "Vasostrict" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2014, "sources": [ { "type": "chembl", "id": "CHEMBL373742", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL373742/", "read": "2026-10-02" }, { "type": "openfda", "id": "NDA204485", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=204485", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "vasopressin", "gpMatch": "name", "innStem": "-pressin", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{C.Y.F.Q.N.C.P.R.G.[am]}$PEPTIDE1,PEPTIDE1,6:R3-1:R3$$$", "sequence": null }, { "id": "vasopressin-tannate", "name": "Vasopressin Tannate", "synonyms": [ "Pitressin tannate" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 1982, "sources": [ { "type": "chembl", "id": "CHEMBL1201528", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1201528/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-pressin", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "veldoreotide", "name": "Veldoreotide", "synonyms": [ "COR-005", "DG-3173", "DG3173", "Dg3173", "PTR 3173", "PTR-3173", "Somatoprim", "Veldoreotida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3989911", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3989911/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2016, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "vensemaglutide", "name": "Vensemaglutide", "synonyms": [ "Vensemaglutida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068314", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068314/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "ventfort", "name": "Ventfort", "synonyms": [ "Vascular peptide bioregulator", "Vessel-wall peptide preparation" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 19830585", "url": "https://pubmed.ncbi.nlm.nih.gov/19830585/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "ventfort", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "vessel-dilator", "name": "Vessel dilator", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P01160", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01160/entry", "note": "mature peptide 56-92 of Natriuretic peptides A" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "EVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQR" }, { "id": "vesugen", "name": "Vesugen", "synonyms": [ "KED tripeptide", "Lys-Glu-Asp", "Vascular tripeptide" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 19830585", "url": "https://pubmed.ncbi.nlm.nih.gov/19830585/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "vesugen", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "vezocolmitide", "name": "Vezocolmitide", "synonyms": [ "Vezocolmitida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068188", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068188/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "vicatertide", "name": "Vicatertide", "synonyms": [ "Vicatertida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314893", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314893/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "vilon", "name": "Vilon", "synonyms": [ "Lysylglutamic acid" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubchem", "id": "CID 7010502", "url": "https://pubchem.ncbi.nlm.nih.gov/compound/7010502", "read": "2026-10-02", "note": "PubChem title: Lysylglutamic acid" } ], "gpEntry": "vilon", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "vip", "name": "VIP", "synonyms": [ "Vasoactive intestinal polypeptide", "Vip" ], "moleculeClass": "peptide", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL525028", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL525028/", "read": "2026-10-02" }, { "type": "uniprot", "id": "P01282", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P01282/entry", "note": "mature peptide 125-152 of VIP peptides" } ], "gpEntry": "vip", "gpMatch": "alias", "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": "PEPTIDE1{H.S.D.A.V.F.T.D.N.Y.[lalloT].R.L.R.K.Q.M.A.V.K.K.[dY].L.N.S.[lalloI].L.N}$$$$", "sequence": null }, { "id": "vipivotide-tetraxetan", "name": "Vipivotide Tetraxetan", "synonyms": [ "177LU-LABELED PSMA-617", "177Lu-PSMA-617", "177lu-psma-617", "DKFZ-PSMA-617", "LUTETIUM LU-177 VIPIVOTIDE TETRAXETAN", "Lutetium (177lu) vipivotide tetraxetan", "Lutetium lu 177 vipivotide tetraxetan", "Lutetium lu-177 vipivotide tetraxetan", "PSMA-617", "PSMA617", "Pluvicto", "Psma-617 lu-177", "Vipivotida tetraxetan", "Vipivotide tetraxetan lu-177", "Vipivotide tetraxetan lutetium lu-177" ], "moleculeClass": "peptidomimetic", "status": "approved", "maxPhase": 4.0, "firstApproval": 2022, "sources": [ { "type": "chembl", "id": "CHEMBL4594280", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4594280/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL4594730", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4594730/", "read": "2026-10-02", "note": "separate ChEMBL record of the same molecule" }, { "type": "chembl", "id": "CHEMBL4594406", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4594406/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "vipivotide-tetraxetan", "gpMatch": "name", "innStem": "-tide; -xetan", "usanYear": 2019, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "vipivotide-tetraxetan-gallium", "name": "Vipivotide Tetraxetan Gallium", "synonyms": [ "68ga-psma-617", "Psma-617 ga-68", "VIPIVOTIDE TETRAXETAN GALLIUM GA-68", "Vipivotide tetraxetan gallium ga-68" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4650685", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4650685/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL4650357", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4650357/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide; -xetan", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "visepegenatide", "name": "Visepegenatide", "synonyms": [ "Visepegenatida" ], "moleculeClass": "peptide-conjugate", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314895", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314895/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-peg-; -tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "visoluten", "name": "Visoluten", "synonyms": [ "Eye peptide preparation", "Retinal peptide bioregulator" ], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 19830585", "url": "https://pubmed.ncbi.nlm.nih.gov/19830585/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "visoluten", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "vk2735", "name": "VK2735", "synonyms": [], "moleculeClass": "peptide", "status": "unknown", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "pubmed", "id": "PMID 41508550", "url": "https://pubmed.ncbi.nlm.nih.gov/41508550/", "read": "2026-10-02", "note": "first PubMed citation on the encyclopedia entry, verified by citation_verify" } ], "gpEntry": "vk2735", "gpMatch": "entry", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "voclosporin", "name": "Voclosporin", "synonyms": [ "Lupkynis" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2021, "sources": [ { "type": "openfda", "id": "NDA213716", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=213716", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "voclosporin", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "vorumotide", "name": "Vorumotide", "synonyms": [ "Vorumotida", "Wt-1 331 long", "Wt1-331 long" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314789", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314789/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "vosoritide", "name": "Vosoritide", "synonyms": [ "BMN 111", "BMN-111", "Bmn 111", "Vosoritida", "Voxzogo" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2021, "sources": [ { "type": "chembl", "id": "CHEMBL3707276", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3707276/", "read": "2026-10-02" } ], "gpEntry": "vosoritide", "gpMatch": "name", "innStem": "-tide", "usanYear": 2016, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "vurolenatide", "name": "Vurolenatide", "synonyms": [ "GLP-1-XTEN", "NB-1001", "NB1001", "NM-002", "Vurolenatida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5095367", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5095367/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2021, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "xelafaslatide", "name": "Xelafaslatide", "synonyms": [ "ONL1204", "Onl-1204", "Onl1204", "Xelafaslatida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068318", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068318/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "xenin", "name": "Xenin", "synonyms": [], "moleculeClass": "peptide", "status": "endogenous", "maxPhase": null, "firstApproval": null, "sources": [ { "type": "uniprot", "id": "P53621", "read": "2026-10-02", "url": "https://www.uniprot.org/uniprotkb/P53621/entry", "note": "mature peptide 1-25 of Coatomer subunit alpha" } ], "gpEntry": null, "gpMatch": null, "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": "MLTKFETKSARVKGLSFHPKRPWIL" }, { "id": "yttrium-y-90-capromab-pendetide", "name": "Yttrium Y 90 Capromab Pendetide", "synonyms": [ "90y-cyt-356", "CYT-356-90Y", "CYT-356-Y-90", "Cyt-356 90y", "Oncoltad" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL2109552", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL2109552/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-mab; -tide", "usanYear": null, "chemblType": "Antibody", "helm": null, "sequence": null }, { "id": "zelenectide", "name": "Zelenectide", "synonyms": [ "BCY-8116", "BCY8126", "BCY8161", "Zelenectida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314902", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314902/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2024, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "zelenectide-pevedotin", "name": "Zelenectide Pevedotin", "synonyms": [ "BT-8009", "BT8009", "Bt8009", "Zelenectida pevedotina", "Zelenectide pavedotin", "Zelenectide pevedotine" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5314903", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5314903/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-dotin; -tide", "usanYear": 2024, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "zelpultide-alfa", "name": "Zelpultide Alfa", "synonyms": [ "AT-100", "AT100", "At 100", "At-100", "Recombinant sp-d" ], "moleculeClass": "peptide", "status": "phase-1", "maxPhase": 1.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL4650375", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4650375/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2021, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "zendusortide", "name": "Zendusortide", "synonyms": [ "TH-19P01", "TH19P01", "Zendusortida" ], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL5095162", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL5095162/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": 2023, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "ziconotide", "name": "Ziconotide", "synonyms": [ ".omega.-conotoxin m viia", "Prialt", "SNX-111", "SNX-111 ACETATE", "Ziconotida" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2004, "sources": [ { "type": "chembl", "id": "CHEMBL1795072", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL1795072/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL4594214", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL4594214/", "read": "2026-10-02", "note": "separate ChEMBL record of the same molecule" } ], "gpEntry": "ziconotide", "gpMatch": "name", "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "zifogaptide", "name": "Zifogaptide", "synonyms": [], "moleculeClass": "peptide", "status": "phase-2", "maxPhase": 2.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL6068192", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL6068192/", "read": "2026-10-02" } ], "gpEntry": null, "gpMatch": null, "innStem": "-tide", "usanYear": null, "chemblType": "Protein", "helm": null, "sequence": null }, { "id": "zilucoplan", "name": "Zilucoplan", "synonyms": [ "Zilbrysq" ], "moleculeClass": "peptide", "status": "approved", "maxPhase": 4.0, "firstApproval": 2023, "sources": [ { "type": "openfda", "id": "NDA216834", "read": "2026-10-02", "url": "https://www.accessdata.fda.gov/scripts/cder/daf/index.cfm?event=overview.process&ApplNo=216834", "note": "earliest NDA/BLA approval in Drugs@FDA via openFDA" } ], "gpEntry": "zilucoplan", "gpMatch": "name", "innStem": null, "usanYear": null, "chemblType": null, "helm": null, "sequence": null }, { "id": "zoptarelin-doxorubicin", "name": "Zoptarelin Doxorubicin", "synonyms": [ "AEZS-108", "AN-152", "AN-52", "Aezs-108", "D-81858", "ZEN-008", "Zoptarelina doxorubicina", "Zoptareline doxorubicine" ], "moleculeClass": "peptide-conjugate", "status": "phase-3", "maxPhase": 3.0, "firstApproval": null, "sources": [ { "type": "chembl", "id": "CHEMBL3544954", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3544954/", "read": "2026-10-02" }, { "type": "chembl", "id": "CHEMBL3989956", "url": "https://www.ebi.ac.uk/chembl/compound_report_card/CHEMBL3989956/", "read": "2026-10-02", "note": "salt form, folded into this row" } ], "gpEntry": "zoptarelin-doxorubicin", "gpMatch": "name", "innStem": "-relin; -rubicin", "usanYear": 2017, "chemblType": "Protein", "helm": null, "sequence": null } ] }